KEGG   Mus musculus (mouse): 20608Help
Entry
20608             CDS       T01002                                 

Gene name
Sstr4, Smstr4, sst4
Definition
(RefSeq) somatostatin receptor 4
  KO
K04220  somatostatin receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    20608 (Sstr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    20608 (Sstr4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Somatostatin
    20608 (Sstr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 20608
NCBI-ProteinID: NP_033245
MGI: 105372
Ensembl: ENSMUSG00000037014
Vega: OTTMUSG00000015711
UniProt: P49660 A0A0R4J1D6
Position
2 G3; 2 73.44 cM
AA seq 385 aa AA seqDB search
MNAPATLPPGVEDTTWTPGINASWAPDEEEEDAMGSDGTGTAGMVTIQCIYALVCLVGLV
GNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVL
SVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAV
FADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVAL
RAGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYAN
SCANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGAGCICPP
LPCQQEPVQAEPGCKQVPFTKTTTF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgccagcaactctgcctccgggggtcgaggacaccacctggacccctgggatc
aacgccagctgggctccggacgaggaggaggaggatgcgatggggtccgacggcacaggg
acagcgggcatggtcactatccagtgcatctatgcgctcgtgtgtctggtgggcctggtg
ggaaacgccctggtcatcttcgtgatcctacgctatgccaagatgaagacagccaccaac
atctacctactcaacctggccgtcgccgatgagctcttcatgctcagcgtgccattcgtg
gcctcggcggctgccctgcgccactggccgttcggggcggtgctgtgtcgcgcagtgctt
agcgtggacggcctgaacatgttcactagtgtcttctgcctcaccgtgctcagcgtggac
cgctatgtggctgttgtgcaccctctgcgcgccgccacctaccggcggcccagcgtggcc
aagctaatcaacctgggagtgtggctagcatccttgctggtcaccctgcccatcgcagtc
ttcgctgacaccaggccagctcgtgggggcgaggccgtggcttgcaacctgcactggcct
cacccggcctggtctgcggtctttgtgatctatacttttttgttgggcttcctactcccg
gttctggccatcggattatgctacctgcttattgtgggcaagatgcgcgctgtggccctg
cgggctggctggcaacaacggaggcgctcagagaagaagatcactaggctcgtgctaatg
gtggtgaccgtctttgtgctatgctggatgcctttctatgtggtgcagcttctgaacctg
tttgtcaccagcctcgatgccactgtcaaccatgtgtccctcatcctgagctatgccaac
agctgtgccaatcccattctctatggcttcctctctgacaacttccggcgctctttccag
cgggttctgtgcctgcgctgctgtctcctggaaacaactggaggtgctgaggaagagccc
ctggactactatgccactgctctcaaaagcagagggggtgcaggatgcatatgccctcct
ctgccctgccagcaggagcccgtgcaagcagaacctggctgcaagcaagtccctttcacc
aagaccactactttctga

DBGET integrated database retrieval system