KEGG   Mus musculus (mouse): 20612
Entry
20612             CDS       T01002                                 

Gene name
Siglec1, Cd169, Siglec-1, Sn
Definition
(RefSeq) sialic acid binding Ig-like lectin 1, sialoadhesin
  KO
K06548  sialoadhesin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    20612 (Siglec1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    20612 (Siglec1)
   04091 Lectins [BR:mmu04091]
    20612 (Siglec1)
CD molecules [BR:mmu04090]
 Proteins
  20612 (Siglec1)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  20612 (Siglec1)
SSDB
Motif
Pfam: Ig_2 Ig_3 I-set ig V-set Ig_4 C2-set_2 Ig_5 Ig_6 C1-set Izumo-Ig
Other DBs
NCBI-GeneID: 20612
NCBI-ProteinID: NP_035556
MGI: 99668
Ensembl: ENSMUSG00000027322
Vega: OTTMUSG00000015684
UniProt: Q62230 G3X8X6
Structure
PDB: 

Position
2 F1; 2 63.26 cM
AA seq 1701 aa
MHLGTGMCVLFSLLLLASVFSLGQTTWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNG
ITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYN
FRFEISDSNRWLDVKGTTVTVTTDPSPPTITIPEELREGMERNFNCSTPYLCLQEKQVSL
QWRGQDPTHSVTSSFQSLEPTGVYHQTTLHMALSWQDHGRTLLCQFSLGAHSSRKEVYLQ
VPHAPKGVEILLSSSGRNILPGDPVTLTCRVNSSYPAVSAVQWARDGVNLGVTGHVLRLF
SAAWNDSGAYTCQATNDMGSLVSSPLSLHVFMAEVKMNPAGPVLENETVTLLCSTPKEAP
QELRYSWYKNHILLEDAHASTLHLPAVTRADTGFYFCEVQNAQGSERSSPLSVVVRYPPL
TPDLTTFLETQAGLVGILHCSVVSEPLATVVLSHGGLTLASNSGENDFNPRFRISSAPNS
LRLEIRDLQPADSGEYTCLAVNSLGNSTSSLDFYANVARLLINPSAEVVEGQAVTLSCRS
GLSPAPDTRFSWYLNGALLLEGSSSSLLLPAASSTDAGSYYCRTQAGPNTSGPSLPTVLT
VFYPPRKPTFTARLDLDTSGVGDGRRGILLCHVDSDPPAQLRLLHKGHVVATSLPSRCGS
CSQRTKVSRTSNSLHVEIQKPVLEDEGVYLCEASNTLGNSSAAASFNAKATVLVITPSNT
LREGTEANLTCNVNQEVAVSPANFSWFRNGVLWTQGSLETVRLQPVARTDAAVYACRLLT
EDGAQLSAPVVLSVLYAPDPPKLSALLDVGQGHMAVFICTVDSYPLAHLSLFRGDHLLAT
NLEPQRPSHGRIQAKATANSLQLEVRELGLVDSGNYHCEATNILGSANSSLFFQVRGAWV
QVSPSPELREGQAVVLSCQVPTGVSEGTSYSWYQDGRPLQESTSSTLRIAAISLRQAGAY
HCQAQAPDTAIASLAAPVSLHVSYTPRHVTLSALLSTDPERLGHLVCSVQSDPPAQLQLF
HRNRLVASTLQGADELAGSNPRLHVTVLPNELRLQIHFPELEDDGTYTCEASNTLGQASA
AADFDAQAVRVTVWPNATVQEGQQVNLTCLVWSTHQDSLSYTWYKGGQQLLGARSITLPS
VKVLDATSYRCGVGLPGHAPHLSRPVTLDVLHAPRNLRLTYLLETQGRQLALVLCTVDSR
PPAQLTLSHGDQLVASSTEASVPNTLRLELQDPRPSNEGLYSCSAHSPLGKANTSLELLL
EGVRVKMNPSGSVPEGEPVTVTCEDPAALSSALYAWFHNGHWLQEGPASSLQFLVTTRAH
AGAYFCQVHDTQGTRSSRPASLQILYAPRDAVLSSFRDSRTRLMVVIQCTVDSEPPAEMV
LSHNGKVLAASHERHSSASGIGHIQVARNALRLQVQDVTLGDGNTYVCTAQNTLGSISTT
QRLLTETDIRVTAEPGLDVPEGTALNLSCLLPGGSGPTGNSSFTWFWNRHRLHSAPVPTL
SFTPVVRAQAGLYHCRADLPTGATTSAPVMLRVLYPPKTPTLIVFVEPQGGHQGILDCRV
DSEPLAILTLHRGSQLVASNQLHDAPTKPHIRVTAPPNALRVDIEELGPSNQGEYVCTAS
NTLGSASASAYFGTRALHQLQLFQRLLWVLGFLAGFLCLLLGLVAYHTWRKKSSTKLNED
ENSAEMATKKNTIQEEVVAAL
NT seq 5106 nt   +upstreamnt  +downstreamnt
atgcacctgggcactgggatgtgtgtcctgttctccctgctcctgctggcctctgtcttc
tcactaggccagaccacatggggtgtctccagtcccaagaatgtgcagggcttgtcggga
tcctgcctgctcattccctgcatcttcagctaccctgccgatgtcccagtgtccaatggc
atcacagccatctggtactatgactactcgggcaagcggcaggtggtaatccactcaggg
gaccccaagctggtggacaagcgtttcaggggtcgagctgaactgatggggaacatggac
cacaaggtgtgcaacctgttgctcaaagacttgaagcctgaagactctggcacctacaac
ttccgctttgagatcagtgatagcaaccgctggttagatgtcaaaggcaccacggtcact
gtgacaacggatcccagcccccccactattaccattcctgaggagctgcgtgaaggcatg
gagaggaacttcaactgttccacaccctacctgtgcctgcaggagaagcaagtcagcctg
cagtggcgaggccaggaccccacccactctgtcacctccagcttccagagcctcgagccc
actggcgtctatcaccagacgaccctacatatggccctatcctggcaggaccacggtcgg
accctgctctgccagttctcattgggcgcacacagtagtcggaaagaggtttacctgcaa
gtgccacatgcccccaaaggtgtggagatcctcctcagctcctcagggaggaacatcctt
cccggggatccagtcacactcacctgcagagtgaacagcagctatcctgctgtcagtgcc
gtgcagtgggccagggacggagtgaacctcggagtcacgggacatgtgcttcggctgttc
tcagcagcctggaatgattctggggcctacacctgccaagcaacaaatgatatgggctct
ctggtgtcatccccgctcagcctccatgtttttatggctgaagtcaaaatgaaccccgca
gggcccgtcttggaaaatgagacagtgactctgctctgtagcacgccgaaggaggctccc
caggagctccgctatagctggtacaagaaccacattctcctggaagatgcccatgcctca
accttgcacctgcctgcagtcaccagggctgatactggcttctacttctgtgaagtgcag
aatgcccagggcagtgagcgctccagtccattgagtgtggtggtcagatatccacccctt
actccagacctgaccaccttcctggagacacaggccggacttgtgggcatcttgcattgc
tccgtggtcagtgagcccctggctactgtggtgctgtcacacggaggcctcacgttggcc
tccaactctggagaaaatgacttcaacccccgattcaggatctcctctgcccccaactcc
ctgcgcctagaaatccgagacttgcagccagcagacagcggagagtacacatgcttagct
gtcaactcccttggaaactcaacgtccagcctagacttctatgctaatgtggcccgactc
ctcatcaacccttcagcagaggttgtggaagggcaggcggtgaccctgagctgcaggagt
ggcctgagcccagctcctgacactcgcttctcctggtacctgaacggagctctacttctg
gaaggatccagcagcagcctcctgcttcctgcggcttccagcactgatgcgggctcatac
tactgtaggacgcaggctggccccaacaccagcggcccctccctgcctactgtcctcact
gtgttctatcccccaagaaagcccacattcactgccaggctggatttggatacctctgga
gtcggggatggacgacggggcatcctcttgtgccacgtagacagcgatcccccagcccag
ctacggcttctccacaaaggccatgttgtggccacttctctgccatcaaggtgtgggagc
tgttcccagcgcacaaaagtcagcagaacctccaactcactgcacgtggagatccagaag
cctgtattagaggatgagggcgtgtacctgtgtgaggctagcaacacattgggcaactcc
tcagccgcagcctctttcaatgctaaggccactgtactggtcatcacaccgtcaaataca
ctgcgtgaaggcacagaggccaacctaacttgcaacgtgaaccaggaggttgctgtcagc
cctgccaacttctcctggttccggaatggagtgctgtggacccagggatcactggagact
gtgaggctgcagcctgtggccagaactgatgctgctgtctatgcctgccgcctcctcacc
gaggatggggctcagctctcggctcctgtggtcctaagtgtgctgtatgccccagaccct
ccaaagctgtcagccctcctagatgtgggtcagggccacatggccgtgttcatctgcact
gtggacagctatcccctggctcacctgtctctgttccgtggggaccatctcctggccacc
aacttggaaccccagcgtccctcccatggcaggatccaggccaaggccacagccaactcc
ctgcagctagaggtccgagaactaggtcttgtggactctggaaactaccactgtgaagcc
accaatattcttgggtcagccaacagttcactcttcttccaggtcagaggagcctgggtc
caggtttcaccatcacctgagctccgggagggccaggctgtggtcctgagctgccaggtg
cccacaggagtctctgaggggacctcatacagctggtatcaggatggccgccccctccag
gagtcaacctcatctacactccgcattgcagccataagtctgaggcaagctggtgcctac
cattgccaagctcaggccccagacacagctattgccagcctggctgcccctgtcagcctc
catgtgtcctataccccacgtcatgttacactcagtgccctgctgagcacggaccctgag
cgactaggccacctggtgtgcagtgtacaaagtgaccctccagcgcagctgcaactgttt
caccggaatcgcctcgtggcctctaccctacaaggcgcggacgaattggcaggcagtaat
ccccggctgcatgtgactgtgctccccaatgagctgcgcctgcagatccactttccagag
ctggaggatgacgggacctatacatgcgaagccagcaacacactgggccaggcctcggct
gcagctgacttcgatgcccaggctgtgcgagtgactgtgtggcccaatgccactgtgcaa
gaggggcagcaggtgaacctgacctgcttggtgtggagcacccaccaggactcactcagc
tacacatggtacaagggcgggcaacaactccttggtgccagatccatcaccctgcccagt
gttaaggttttggatgctacctcctaccgctgtggtgtggggctccccggccacgcaccc
catctctccagacccgtgaccctggatgtcctccatgctccccgaaacctgcggctgacc
tacctcctagagacccagggcaggcagctggccctggtactgtgtacggtggatagtcgt
ccacctgcccagctaactctcagccatggtgaccagcttgtagcctcctcaactgaagcc
tctgtccccaacaccctgcgcctagagcttcaggatccaaggcctagtaatgaggggctc
tatagctgctctgcccacagcccattgggcaaggccaacacgtccctggaacttctgctg
gaaggtgtccgagtgaaaatgaatccctctggtagtgtacccgagggagagcctgtcaca
gtgacctgcgaggaccctgctgccctctcatccgccctctatgcctggtttcacaatggc
cattggcttcaggagggaccggcttcctcactccagttcctggtgactacacgggctcac
gctggtgcttacttttgccaggtgcatgatacacaaggcacacggagctccagacctgcc
agcctgcaaattctctatgccccccgggatgctgtcctgtcttcctttcgagactcaagg
accaggctcatggtcgtgattcagtgcaccgtggacagtgagccacctgctgagatggtc
ctatcccacaatggcaaggtgctagctgccagccacgagcgtcacagctcagcatcaggg
ataggccacatccaggtagcccgaaatgctcttcgactacaagtgcaagatgtgactctg
ggtgatggcaacacctatgtttgcacagcccagaatacactgggctccatcagtaccacc
cagaggcttctgacggagactgatatacgtgtgacagctgagccaggcttggatgtgcca
gagggcacagctctgaacttaagctgcctcctccctggtggctctgggcccacgggcaac
tcttccttcacgtggttctggaatcgccaccgactacattcagctcctgtgcccacactc
tccttcacccctgtggtccgggctcaggctgggctgtaccactgcagggctgatctcccc
accggggccactacctctgctccagttatgctccgtgtcctctatccccccaagacgccc
actctcatagtgtttgtggagcctcagggtggccaccagggcatcctcgactgtcgagtg
gacagtgagcccctggccatcctcactcttcaccggggcagtcaactagtagcctccaac
caacttcacgatgctcccaccaagccccacatccgagtcactgctcctcccaatgccttg
agagtggacatagaggagctcggccctagcaatcaaggggagtatgtgtgcactgcctcc
aacactctgggctctgcctcagcctctgcctactttgggaccagagctctgcaccaactg
cagctgttccagaggctgctctgggtcctgggatttctggcaggcttcctgtgcctgctg
ctgggtctggtggcctatcacacctggagaaagaagagttctaccaagctgaatgaggat
gagaattcagcagagatggccactaagaaaaatactatccaggaggaagtggttgctgct
ctctga

DBGET integrated database retrieval system