KEGG   Mus musculus (house mouse): 20618
Entry
20618             CDS       T01002                                 
Symbol
Sncg, C79089, persyn
Name
(RefSeq) synuclein, gamma
  KO
K24202  gamma-synuclein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    20618 (Sncg)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   20618 (Sncg)
SSDB
Motif
Pfam: Synuclein Mononeg_mRNAcap
Other DBs
NCBI-GeneID: 20618
NCBI-ProteinID: NP_035560
MGI: 1298397
Ensembl: ENSMUSG00000023064
Vega: OTTMUSG00000034011
UniProt: Q9Z0F7 Q5GQ64
Position
14:complement(34092231..34096626)
AA seq 123 aa
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTK
EQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKS
GED
NT seq 372 nt   +upstreamnt  +downstreamnt
atggacgtcttcaagaaaggcttctccattgccaaggaaggtgttgtgggtgctgtagaa
aagaccaagcagggagtaacggaggcagctgagaagaccaaggagggggttatgtatgtg
ggcaccaaaaccaaggagaacgtggtacaaagtgtcacctcagtggctgagaagaccaag
gagcaggccaatgccgtgagtgaagctgtggtcagcagcgtcaacacagtggccaacaag
accgtggaggaggctgaaaacatcgtggtcaccaccggggtggtgcgcaaggaggacttg
gaaccccctgcacaggaccaagaagccaaagagcaagaggagaatgaagaggccaagagt
ggagaagactag

DBGET integrated database retrieval system