KEGG   Mus musculus (mouse): 20620Help
Entry
20620             CDS       T01002                                 

Gene name
Plk2, Snk
Definition
(RefSeq) polo like kinase 2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    20620 (Plk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20620 (Plk2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20620 (Plk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     20620 (Plk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   20620 (Plk2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    20620 (Plk2)
   Centrosome duplication proteins
    Regulators of centriole replication
     20620 (Plk2)
  Sister chromatid separation proteins
   Polo kinases
    20620 (Plk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 20620
NCBI-ProteinID: NP_690017
MGI: 1099790
Ensembl: ENSMUSG00000021701
UniProt: P53351 Q548A9 Q3TV29
Position
13; 13 D2.1
AA seq 682 aa AA seqDB search
MELLRTITYQPAAGTKMCEQALGKACGGDSKKKRPQQPSEDGQPQAQVTPAAPHHHHHHS
HSGPEISRIIVDPTTGKRYCRGKVLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQ
REKIDKEIELHRLLHHKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVR
YYLRQIVSGLKYLHEQEILHRDLKLGNFFINEAMELKVGDFGLAARLEPLEHRRRTICGT
PNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSL
LAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDRLSSSCCHTVPDFHLSSPAKNF
FKKAAAALFGGKKDKARYNDTHNKVSKEDEDIYKLRHDLKKVSITQQPSKHRADEEPQPP
PTTVARSGTSAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCL
ENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGFGYQLSDHTVGVLFNNGAHMSLLPDKKT
VHYYAELGQCSVFPATDAPEQFISQVTVLKYFSHYMEENLMDGGDLPSVTDIRRPRLYLL
QWLKSDKALMMLFNDGTFQVNFYHDHTKIIICNQSEEYLLTYINEDRISTTFRLTTLLMS
GCSLELKNRMEYALNMLLQRCN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctgcggactatcacctaccagccggccgccggcaccaagatgtgcgagcag
gctctgggcaaagcttgcggcggggactcaaagaagaagcgaccgcagcagccttctgaa
gatgggcagccccaagcccaggtgaccccggcggccccgcaccaccatcaccaccattcc
cactcgggacccgagatctcgcggattatagtcgaccccacgacggggaagcgctactgc
cggggcaaagtgctgggcaagggtggatttgcaaagtgttacgaaatgacagatctgaca
aacaacaaagtctacgctgcaaaaattattcctcacagcagagtagctaaacctcatcag
agggaaaagatcgacaaagaaatcgagcttcacagactactgcaccataagcatgtcgtg
cagttttaccactactttgaagacaaagaaaacatttacattctcttggaatactgcagt
agaaggtccatggctcacatcttgaaagcaagaaaggtgttgacagagccagaagtccga
tactacctcaggcagattgtgtcaggactcaagtatcttcacgaacaagaaatcttgcac
agggatctcaagctagggaacttttttattaatgaagccatggagctgaaggtgggagac
tttggtttggcagccagactggaaccactggaacacagaaggagaacaatatgtggaacc
ccaaattatctctcccccgaagtcctcaacaaacaaggacacggctgtgaatcagacatc
tgggccttaggctgtgtaatgtatacgatgctgctaggaagacctccattcgaaaccaca
aatctgaaagaaacgtacaggtgcataagggaagcaaggtataccatgccatcctcattg
ctggcccctgctaagcacttgatagctagcatgctgtccaaaaacccagaggaccgcccc
agtttggatgacatcattcggcatgacttcttcctgcagggtttcactccggacagactc
tcttccagctgttgccacacagttccagatttccacttgtcaagcccagccaagaatttc
tttaagaaagccgcagccgctctttttggtggcaagaaggacaaagcaagatataacgac
acacacaataaggtgtctaaggaagatgaagacatttacaagcttcggcatgatttgaag
aaagtgtcgataacccagcagcctagcaaacacagagcagatgaggagccccagccgcct
cccactactgttgccagatctggaacgtccgcagtggaaaacaaacagcagattggggat
gcaatccggatgatagtcagggggactctcggcagctgcagcagcagcagcgaatgcctt
gaagacagcaccatgggaagtgtggcagacacagtggcaagagtccttcgaggatgtcta
gaaaacatgccggaagctgactgtatccccaaagagcagctgagcacgtcctttcagtgg
gtcaccaagtgggtcgactactccaacaaatacggctttgggtaccagctctcggaccac
actgttggcgtccttttcaacaacggggctcacatgagcctccttccggacaaaaagaca
gttcactattatgcggaacttggccaatgctctgttttcccagcaacagatgcccctgaa
caatttattagtcaagtgacggtgctgaaatacttttctcattacatggaggagaacctc
atggatggtggtgatctcccgagtgttactgacattcgaagacctcggctctacctcctg
cagtggttaaagtctgataaagccttaatgatgctcttcaatgacggcacatttcaggtg
aatttctaccacgatcatacaaaaatcatcatctgtaaccagagtgaagaataccttctc
acctacatcaatgaggacaggatctctacaactttcagactgacgactctgctgatgtct
ggctgttcgttagaattgaaaaatcgaatggaatatgccctgaacatgctcttacagaga
tgtaactga

DBGET integrated database retrieval system