KEGG   Mus musculus (house mouse): 20648
Entry
20648             CDS       T01002                                 
Symbol
Snta1, AW228934, Snt1
Name
(RefSeq) syntrophin, acidic 1
  KO
K24063  alpha-syntrophin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20648 (Snta1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   20648 (Snta1)
SSDB
Motif
Pfam: PH_17 PDZ PH PDZ_6 Peptidase_M50 PDZ_2
Other DBs
NCBI-GeneID: 20648
NCBI-ProteinID: NP_033254
MGI: 101772
Ensembl: ENSMUSG00000027488
UniProt: Q3UVD6 A2AKD7
Position
2:complement(154218234..154250004)
AA seq 499 aa
MASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNG
AAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQT
EALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVG
WDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDA
VFLRAKDEASARSWAGAIQAQIGTFIPWVKDELQALLTATGTAGSQDIKQIGWLTEQLPS
GGTAPTLALLTEKELLFYCSLPQSREALSRPTRTAPLIATRLVHSGPSKGSVPYDAELSF
ALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGIQEVSTACTWNGRPCSLSVH
IDKGFTLWAAEPGAARAMLLRQPFEKLQMSSDDGTSLLFLDFGGAEGEIQLDLHSCPKTM
VFIIHSFLSAKVTRLGLLA
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgtcaggcaggcgcgctccgcgcaccgggttgctggaactgcgctgcggggcgggc
tccggggcgggtggcgagcggtggcagcgggtgttgctctctctggcggaggacgcgctg
accgtgagtcccgccgacggcgagcccggcccggagccggagcccgcgcagctcaacggc
gccgctgagcccggcgcggcgcccccacagctgccagaagcgctgctgctccagcggcgc
cgcgtgacggtgcgcaaggccgacgccggcgggctgggcatcagcatcaaggggggccgg
gaaaacaagatgcctattctcatttccaagatcttcaagggactggcagcagaccagacg
gaggccctttttgttggggatgccatcctgtctgtgaatggtgaagatttgtcctctgcc
acccacgatgaagcggtacaggccctcaagaagacaggcaaggaggttgtgttggaggtt
aagtacatgaaggaggtctcaccctatttcaagaattctgctggagggacctccgttggc
tgggactcacctcctgcctcgcctcttcagcggcagccttcttcccctggcccccaaccc
cggaacctcagtgaggccaaacacgtatctttgaagatggcgtatgtctcaaggaggtgc
acccccactgacccagagcccaggtacctggagatctgtgcagcggacggccaggacgct
gtcttcttgagggccaaggatgaggccagcgcaaggtcatgggcgggcgccatccaagcg
cagatcggcacattcataccttgggtcaaagatgagctccaggctctgctgacagccaca
ggtacagctgggagccaggacatcaagcagattggctggctgacagaacagttgcccagc
gggggaacggcaccaaccctggccctgctgactgagaaggagctgctcttctactgctct
ctccctcagagccgagaggccctgagcaggccgacccgcactgccccgctcattgccacc
aggctggtgcactcaggcccctccaagggctcagtgccctatgatgcagaactctccttt
gccctgcgcacgggtacacggcacggtgtggacactcacctgttcagtgtggagtcgccg
caagagctggcagcctggacccgacagttggtggatggctgtcatcgggctgctgaaggc
atacaagaagtgtctacagcctgcacgtggaacggccgtccctgcagcctgtctgtgcac
atcgacaagggcttcaccctgtgggcagctgagcctggagcagcccgagccatgctgctc
cgacagcccttcgagaaacttcagatgtcatcagatgatggcacgagtctccttttcctg
gactttgggggtgctgaaggagagatccagctggacctgcactcgtgtcccaaaacgatg
gtctttatcatccactctttcctgtccgccaaggtcacccgcttggggctcttggcctag

DBGET integrated database retrieval system