KEGG   Mus musculus (house mouse): 20649
Entry
20649             CDS       T01002                                 
Symbol
Sntb1
Name
(RefSeq) syntrophin, basic 1
  KO
K24064  beta-syntrophin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20649 (Sntb1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   20649 (Sntb1)
SSDB
Motif
Pfam: PH_17 PDZ PH PDZ_6 PDZ_2 Peptidase_M50
Other DBs
NCBI-GeneID: 20649
NCBI-ProteinID: NP_057876
MGI: 101781
Ensembl: ENSMUSG00000060429
UniProt: Q99L88
Position
15:complement(55499791..55770944)
AA seq 537 aa
MAVAAAAVAAPAGGGGARAQRSGLLEVLVRDRWHKVLVNLSEDALVLSCEEGAAAYNGIG
AATNGSFCRGSGTGHPVPGVAQAPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELG
GLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNGADLRDATHDEAVQALK
RAGKEVLLEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGGGSAEPLSSQSFSFHRDR
KSIPLKMCYVTRNMTLADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSAIHSNAGDLL
TRVVADIREQLGKTGIAGSREIRHLGWLAEKVPGESEKQWKPALVVLTEKDLLIYDSMPR
RKEAWFSPVHSYPLLATRLVHSGPGKGSPQAGMDLSFATRTGTKQGIETHLFRAEISRDL
SHWTRSIVQGCHNSAELTAEITTACTYRNQECRLTIHYDNGFSISTEPQDGAFPKTIIQS
PYEKLKMSSDDGIRMLYLDFGGKEGEIQLDLHSCPKPIVFIIHSFLSAKITRLGLVA
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcggtagcggcagcggctgtggctgcgccggctggcggtggaggcgcccgggcgcag
cggagcggactgctggaagttttggtgcgggatcgctggcataaagttctggtgaacttg
agcgaggacgccctggtgttgagctgcgaggagggcgctgcggcgtacaacggcataggg
gctgccaccaatggttcgttctgcaggggctccgggaccgggcacccggtccccggtgtc
gctcaagccccggactctcccgccggggtccgcaccgccttcaccgacctcccggagcag
gtacctgagtccatctcaaaccagaagaggggcgtgaaggtgctgaagcaggagctgggc
gggctgggcattagcatcaaagggggcaaggaaaacaagatgcccatactcatcagcaag
atcttcaaggggctggcagcggatcagacccaagccctgtatgtgggcgatgccatcctg
tcggtgaacggagcagacctgcgggacgccacccacgacgaggcagtgcaggcattgaag
cgcgcaggcaaggaagtgctgctggaagtgaagtatatgagagaagccacaccttacgtg
aagaaagggtccccggtgtctgagattggatgggaaacacctccacctgagtctccaaga
ttagggggtggctctgcagagcctctgtcatcccagtccttctccttccatagagaccgg
aaaagcatccccctcaagatgtgttatgtcacccggaacatgaccttggctgaccctgaa
aacaggcagctagaaattcactcgccagatgctaagcacacagtgattctgagaagtaag
gactctgccactgcccaagcctggttcagcgccattcattccaacgctggtgacttgctg
acccgtgtggttgctgacatcagggagcagctggggaaaacaggcattgctggcagtcgt
gagatcaggcatcttggctggcttgcagaaaaggtgcccggagagagtgagaaacagtgg
aaaccagccctggttgttctgactgagaaagatcttttaatctacgacagcatgccacgg
aggaaagaggcctggttcagcccggtgcattcgtatccacttcttgctaccaggctggtc
cattcaggtccagggaaaggatcaccccaggctgggatggatctgtcctttgcaacacga
actggcaccaagcaaggaattgaaacacatctcttcagggcagagatcagcagggacctc
tcccactggacaagaagcatagtacaggggtgccacaattcagcggagctcactgccgaa
atcaccacagcctgcacctacagaaaccaggaatgccgcttgaccatacattatgacaat
ggattttctatttccactgagcctcaggatggtgccttccccaagacaatcatacagtcc
ccttatgagaagctcaaaatgtcttcggatgatggaatcaggatgctctatttagacttt
ggaggcaaagaaggagagattcaactggaccttcactcctgccccaagccgatcgttttc
atcatccactcctttctgtctgctaagataacacgactgggcttggtggcctga

DBGET integrated database retrieval system