KEGG   Mus musculus (house mouse): 20650
Entry
20650             CDS       T01002                                 
Symbol
Sntb2, SNT3, SNTL, Snt2
Name
(RefSeq) syntrophin, basic 2
  KO
K24064  beta-syntrophin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20650 (Sntb2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  Other PDZ domain-containing proteins
   20650 (Sntb2)
SSDB
Motif
Pfam: PH_17 PDZ PH PDZ_6 Peptidase_M50 PDZ_2
Other DBs
NCBI-GeneID: 20650
NCBI-ProteinID: NP_033255
MGI: 101771
Ensembl: ENSMUSG00000041308
UniProt: Q61235 Q542S9
Position
8:107662372..107740864
AA seq 520 aa
MAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAVEPEPPAAAFNGLPNGGGG
ESLPGSPNRGLGPPSPPAPPRGPAGEASASPPVRRVRVVKQEAGGLGISIKGGRENRMPI
LISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREV
TPYIKKPSLVSDLPWEGASPQSPSFSGSEDSGSPKHQNTTKDRKVIPLKMCFAARNLSMP
DLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATSTA
GGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPCHSYPLV
ATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLSTWTRILVQGCHAAA
ELIKEVSLGCTLSGQEVRFTVHYEHGFTITRDNGGASSILYRYPFERLKMSADDGIRNLY
LDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggtgtggacgcgggccaccaaagcggggctggtggagctgcttctaagggagcgc
tgggtgcgggtggtggccgagctcagtggcgagagcctgagcctgacgggcgacgccgcc
gcagtcgagcctgagccgccggcggccgccttcaacggtcttccgaacggcggcggcggc
gagtctctgcccgggagcccgaaccgtggcctggggccgcccagccctcccgcgccgccc
cgcggtcccgcgggggaagcgagcgcctcgccgcccgtgcgccgagtgcgagtggtgaag
caagaggcgggcggcctgggcatcagcatcaagggcggccgcgagaaccggatgccgatc
ctcatctccaagatcttcccggggctggcggccgaccagagccgggcgctgcggctgggc
gacgccatcctgtcggtgaacggcaccgacctgcgccaggccacccacgaccaggccgtg
caggcgctgaagcgcgcgggcaaggaggtgctgctggaggtcaaattcatccgagaagta
acaccatatatcaagaaaccatctttagtatcagatctgccatgggaaggtgcctctccc
cagtctccaagctttagtggcagtgaagactctggctctccaaagcatcagaacaccacc
aaggacaggaaggtcatccctctcaaaatgtgctttgctgctcgaaacctgagcatgcca
gatctggagaacagattgatagagctacattctcctgatagcaggaacaccttgatctta
cgctgcaaggatacggccacagcacactcctggttcgtagctatccacaccaacataatg
gctctcctcccacaggtactggctgagctcaatgccatgcttggtgcaaccagtacagcg
ggaggcagcaaggaagtcaagcatattgcctggctggcagagcaggcaaagctggatggt
ggacgacagcagtggaggcctgttctcatggctgtgactgagaaggacttgctactttat
gactgcatgccttggacaagagatgcctgggcatcaccgtgtcatagctaccctcttgtt
gccacaaggttggttcattcaggttctggatgtcggtcaccctcccttggatctgacctg
acctttgctaccaggacaggctctcggcagggcattgagatgcatctcttcagggttgaa
actcatcgggatttgtcgacctggaccagaatacttgttcagggctgccatgctgctgct
gagctgatcaaggaagtctccctaggctgcaccttaagtggccaagaggtaaggttcact
gtccactatgaacacgggttcactatcaccagagacaatggaggcgccagcagcatattg
taccgctatccctttgaacggctgaagatgtctgctgatgatggaatcagaaatctctat
ttggattttggtggccctgagggagaactgactatggacctgcattcttgtccaaagccg
attgtatttgtattgcacacgttcttatccgccaaagtcactcgcatgggactgcttgtg
tga

DBGET integrated database retrieval system