KEGG   Mus musculus (mouse): 20652Help
Entry
20652             CDS       T01002                                 

Gene name
Soat1, 8430426K15Rik, ACAT-1, AW550831, Acact, ald, hid
Definition
(RefSeq) sterol O-acyltransferase 1
  KO
K00637  sterol O-acyltransferase [EC:2.3.1.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00100  Steroid biosynthesis
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    20652 (Soat1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    20652 (Soat1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.26  sterol O-acyltransferase
     20652 (Soat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT ATP_synt_H
Motif
Other DBs
NCBI-GeneID: 20652
NCBI-ProteinID: NP_033256
MGI: 104665
Ensembl: ENSMUSG00000026600
Vega: OTTMUSG00000049652
UniProt: Q61263
Position
1 G3; 1 67.71 cM
AA seq 540 aa AA seqDB search
MSLRNRLSKSGENPEQDEAQKNFMDTYRNGHITMKQLIAKKRLLAAEAEELKPLFMKEVG
CHFDDFVTNLIEKSASLDNGGCALTTFSILEEMKKNHRAKDLRAPPEQGKIFISRQSLLD
ELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEGRLVLEFNLLAYAFGKFPTVIWTWWA
MFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPP
ASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPLPTVNQYLYFLFAPTLIYRD
NYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSI
LPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYY
YVYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIV
NDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCRYVF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtcactaagaaaccggctgtcaaaatctggggagaatcctgagcaagatgaagcccag
aaaaatttcatggacacatacagaaatggtcacattaccatgaaacaattgatagccaag
aagaggctgttggcagcagaggcggaggagctgaagccactatttatgaaggaagttggg
tgccacttcgatgactttgtgaccaacctcattgaaaagtccgcatcgctggacaatggt
gggtgtgcactcacaaccttctccattcttgaagaaatgaaaaagaaccacagagccaaa
gatctgagagcacctccagaacaagggaagatttttatttcaaggcagtctcttttagac
gagctgtttgaagtggaccacatcagaacaatttaccacatgttcatcgcactcctcatc
ctattcgtcctcagcacgatcgtcgtggactacatcgatgaaggaaggctggtacttgag
ttcaatctcctggcctatgcttttggcaaatttcctactgttatttggacatggtgggcc
atgttcctgtctacactgtcaatcccctatttcctgttccagcgatgggcccacggttac
agcaagagttctcacccattgatctattcccttgtccatggcttgctcttcttagtcttt
caacttggagttctaggttttgtgccaacatacgttgtcttagcatacacactgccacca
gcctcccggttcattctgatactggaacagattcgtttgataatgaaggctcactcattt
gtcagagagaatatcccacgagtactaaatgcagccaaggagaaatcaagcaaagatcca
ctacccacagtcaaccagtacctgtacttcctgtttgcgcctacacttatttaccgagac
aactacccaaggactcctactgtaagatggggttatgtcgctatgcagtttttacaggtg
tttggctgcctgttttatgtgtactacatctttgagagactctgtgccccactattccgg
aatatcaaacaggagcccttcagtgctcgtgtcctggtcctgtgtgtgtttaactccatc
ttgccaggtgtcttgatactgttcctttcgttctttgcctttttgcactgctggctcaat
gcctttgctgagatgttacgctttggtgacaggatgttttataaggactggtggaactct
acatcatactccaactactacaggacctggaacgtggtggtgcacgactggctctactac
tatgtttacaaagacctgctctggtttttctcgaagaggttcaaatctgccgccatgctg
gccgtcttcgccctgtcggctgtggtgcacgagtatgccctcgccatctgcctgagttac
ttctacccggtgctcttcgtgctcttcatgttctttggaatggcttttaacttcattgtt
aacgacagtcggaaaaggccaatctggaacatcatggtttgggcttctctgttcctgggc
tatggactcattctgtgcttttattctcaagagtggtatgcccgccagcactgtcctctg
aagaaccctacatttctggattatgtccggccgcggacctggacttgtcggtacgtgttt
tag

DBGET integrated database retrieval system