KEGG   Mus musculus (mouse): 20655
Entry
20655             CDS       T01002                                 

Gene name
Sod1, B430204E11Rik, Cu/Zn-, Cu/Zn-SOD, CuZn, CuZnSOD, I, Ip, Ipo-1, Ipo1, SO, SODC, Sod, Sod-1
Definition
(RefSeq) superoxide dismutase 1, soluble
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
mmu04213  Longevity regulating pathway - multiple species
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    20655 (Sod1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    20655 (Sod1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    20655 (Sod1)
   05016 Huntington disease
    20655 (Sod1)
   05020 Prion disease
    20655 (Sod1)
   05022 Pathways of neurodegeneration - multiple diseases
    20655 (Sod1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     20655 (Sod1)
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-GeneID: 20655
NCBI-ProteinID: NP_035564
MGI: 98351
Ensembl: ENSMUSG00000022982
UniProt: P08228
Structure
PDB: 
3GTT

Position
16 C3.3; 16 51.56 cM
AA seq 154 aa
MAMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTS
AGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVV
HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcgatgaaagcggtgtgcgtgctgaagggcgacggtccggtgcagggaaccatccac
ttcgagcagaaggcaagcggtgaaccagttgtgttgtcaggacaaattacaggattaact
gaaggccagcatgggttccacgtccatcagtatggggacaatacacaaggctgtaccagt
gcaggacctcattttaatcctcactctaagaaacatggtggcccggcggatgaagagagg
catgttggagacctgggcaatgtgactgctggaaaggacggtgtggccaatgtgtccatt
gaagatcgtgtgatctcactctcaggagagcattccatcattggccgtacaatggtggtc
catgagaaacaagatgacttgggcaaaggtggaaatgaagaaagtacaaagactggaaat
gctgggagccgcttggcctgtggagtgattgggattgcgcagtaa

KEGG   Mus musculus (mouse): 20656
Entry
20656             CDS       T01002                                 

Gene name
Sod2, Mn, MnSOD, Sod, Sod-2
Definition
(RefSeq) superoxide dismutase 2, mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04146  Peroxisome
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu05016  Huntington disease
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    20656 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    20656 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    20656 (Sod2)
   04213 Longevity regulating pathway - multiple species
    20656 (Sod2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20656 (Sod2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20656 (Sod2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     20656 (Sod2)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-GeneID: 20656
NCBI-ProteinID: NP_038699
MGI: 98352
Ensembl: ENSMUSG00000006818
UniProt: P09671 Q4FJX9
Position
17 A1; 17 8.75 cM
AA seq 222 aa
MLCRAACSTGRRLGPVAGAAGSRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK
NT seq 669 nt   +upstreamnt  +downstreamnt
atgttgtgtcgggcggcgtgcagcacgggcaggaggctgggccctgtggccggtgccgcg
ggctcccggcacaagcacagcctcccagacctgccttacgactatggcgcgctggagcca
cacattaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aatctcaacgccaccgaggagaagtaccacgaggctctggccaagggagatgttacaact
caggtcgctcttcagcctgcactgaagttcaatggtgggggacatattaatcacaccatt
ttctggacaaacctgagccctaagggtggtggagaacccaaaggagagttgctggaggct
atcaagcgtgactttgggtcttttgagaagtttaaggagaagctgacagccgtgtctgtg
ggagtccaaggttcaggctggggctggcttggcttcaataaggagcaaggtcgcttacag
attgctgcctgctctaatcaggacccattgcaaggaacaacaggccttattccgctgctg
gggattgacgtgtgggagcacgcttactaccttcagtataaaaacgtcagacctgactat
ctgaaagctatttggaatgtaatcaactgggagaatgttactgaaagatacacagcttgc
aagaagtga

DBGET integrated database retrieval system