KEGG   Mus musculus (mouse): 20667
Entry
20667             CDS       T01002                                 

Gene name
Sox12, 2010205A02Rik
Definition
(RefSeq) SRY (sex determining region Y)-box 12
  KO
K09268  transcription factor SOX11/12 (SOX group C)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20667 (Sox12)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    20667 (Sox12)
SSDB
Motif
Pfam: HMG_box HMG_box_2 OAR
Other DBs
NCBI-GeneID: 20667
NCBI-ProteinID: NP_035568
MGI: 98360
Ensembl: ENSMUSG00000051817
Vega: OTTMUSG00000015843
UniProt: Q04890
Position
2; 2 G3
AA seq 314 aa
MVQQRGARAKRDGGPPPPGPGPAAEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMD
QWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPA
KARPRPPGGGGGGSRLKPGPQLPGRGGRRASGGPLGGGAAAPEDDDEDEEEELLEVRLLE
TPGRELWRMVPAGRAARGPAERAQGPSGEGAAASAASPTLSEDEEPEEEEEEAATAEEGE
EETVVSGEEPLGFLSRMPPGPAGLDCSALDRDPDLLPPSGTSHFEFPDYCTPEVTEMIAG
DWRSSSIADLVFTY
NT seq 945 nt   +upstreamnt  +downstreamnt
atggtgcagcagcggggcgcgcgggccaagcgggacggcgggccgccgcccccggggccc
gggccggccgccgagggggcgcgcgagccaggctggtgcaagaccccgagcggccacatt
aagcggccgatgaacgcgttcatggtgtggtcgcagcacgagcggagaaaaatcatggac
cagtggcccgacatgcacaacgctgagatctccaagcgcctgggccgccgctggcagctg
ctgcaggactcggagaagatcccgttcgtgcgggaggcggagcggctgcgcctcaagcac
atggcggactacccggactacaagtaccggcctcgcaagaagagcaagggggcgcccgcc
aaggcgcggccccgcccccccggaggcggcggtggtggcagtcggctgaaacccgggcca
cagctgccgggccgcgggggccgccgagcgtcgggaggacctctggggggcggcgcggcg
gcgccggaggacgacgacgaagacgaagaggaggagctgctggaagtacgcctgctggag
acccccgggcgcgagctgtggaggatggtcccggcggggcgcgccgcccgcggacccgcg
gagcgcgcgcaggggccatccggcgagggggcggccgccagcgccgcctctccgaccctg
tccgaggacgaggagccggaggaagaggaggaggaggcggctacagcagaggagggcgaa
gaggagacggtggtatctggggaggagccactgggctttctgtccaggatgcccccgggc
cccgccggcctggactgcagtgccctggaccgtgacccggacctgctgcccccttcgggc
acgtcacatttcgaattcccggactattgcacccccgaggttaccgagatgatcgcaggg
gactggcgctcgtctagtatcgccgacctggttttcacctactga

DBGET integrated database retrieval system