KEGG   Mus musculus (mouse): 20669Help
Entry
20669             CDS       T01002                                 

Gene name
Sox14
Definition
(RefSeq) SRY (sex determining region Y)-box 14
  KO
K09267  transcription factor SOX1/3/14/21 (SOX group B)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20669 (Sox14)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    20669 (Sox14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 SOXp
Motif
Other DBs
NCBI-GeneID: 20669
NCBI-ProteinID: NP_035570
MGI: 98362
Ensembl: ENSMUSG00000053747
Vega: OTTMUSG00000044377
UniProt: Q04892 Q3UUP3 Q497H4 Q7TNS9
Position
9 E3.3; 9 52.11 cM
AA seq 240 aa AA seqDB search
MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDE
AKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLS
APEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATSALPYASTLGYQNGAFGSL
SCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaccttcagaccacatcaagcggcccatgaatgccttcatggtatggtcccgg
ggccagcggcgcaagatggcccaggaaaatcccaagatgcacaactcggagatcagcaaa
cgcctgggcgccgaatggaagctcctgtccgaggcagagaagcggccttacatcgatgaa
gccaaaaggctgcgcgcccaacacatgaaggagcaccctgactacaagtaccggccgcgg
cgcaagccgaagaacctgctcaagaaggacaggtatgtcttccccctgccctacctgggc
gacacggacccgctcaaggcggccggcctgcccgtgggggcttccgacggcctcctgagc
gcgcccgagaaagcccgggccttcttgccgcctgcctcggcaccttactccctgctggac
cctgcgcaatttagttccagtgccatccagaagatgggtgaagtgccccacacgttggcc
accagcgcgctgccctacgcgtccaccctgggctatcagaacggcgccttcggcagtctc
agctgccccagccagcacacgcacacgcacccgtcccccaccaacccgggctacgtggtg
ccctgtaactgtaccgcctggtctgcctccaccctgcagccccctgtcgcctacatcctc
ttcccaggcatgaccaagactggcatagacccttattcgtcagcccacgctacggccatg
taa

DBGET integrated database retrieval system