KEGG   Mus musculus (mouse): 20679Help
Entry
20679             CDS       T01002                                 

Gene name
Sox6, AI987981, SOX-LZ
Definition
(RefSeq) SRY (sex determining region Y)-box 6
  KO
K09269  transcription factor SOX5/6/13 (SOX group D)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20679 (Sox6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    20679 (Sox6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 MPS2
Motif
Other DBs
NCBI-GeneID: 20679
NCBI-ProteinID: NP_001264255
MGI: 98368
Ensembl: ENSMUSG00000051910
Vega: OTTMUSG00000058723
UniProt: P40645 Q8BSS6 Q3V1J7
Position
7 F1; 7 61.29 cM
AA seq 827 aa AA seqDB search
MSSKQATSPFACTADGEEAMTQDLTSREKEEGSDQHPASHLPLHPIMHNKPHSEELPTLV
STIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSREREIMNSVTFGTP
ERRKGSLADVVDTLKQKKLEEMTRTEQEDSSCMEKLLSKDWKEKMERLNTSELLGEIKGT
PESLAEKERQLSTMITQLISLREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQ
QQQLLQQQHKINLLQQQIQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGITYKPG
DNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINPRLKGISDRFGRNLDPSEHGGGHS
YNHRQIEQLYAAQLASMQVSPGAKMPSTPQPPNSAGAVSPTGIKNEKRGTSPVTQVKDET
TAQPLNLSSRPKTAEPVKSPTSPTQNLFPASKTSPVNLPNKSSIPSPIGGSLGRGSSLDI
LSSLNSPALFGDQDTVMKAIQEARKMREQIQREQQQQPHGVDGKLSSMNNMGLSNCRTEK
ERTRFENLGPQLTGKSSEDGKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGAT
VAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKS
MSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQLMRSRRQEM
RQFFTVGQQPQMPITTGTGVVYPGAITMATTTPSPQMTSDCSSTSASPEPSLPVIQSTYG
MKMDGASLAGNDMINGEDEMEAYDDYEDDPKSDYSSENEAPEPVSAN
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagcaagccacctctccatttgcctgtacagcggatggagaggaagcaatg
acccaggacttgacctcaagggaaaaggaagagggcagtgatcaacacccggcctcccat
ctgcctctgcaccccataatgcacaacaaacctcactctgaggagctgcctacacttgtc
agtaccattcaacaagatgctgactgggacagcgttctgtcatctcagcaaagaatggag
tcagagaataataagttatgttccctatattccttccgaaatacgtctacctcaccacat
aagcctgacgaagggagtcgggagcgtgaaataatgaacagtgttacttttggaaccccg
gaacgccgcaaagggagccttgccgatgtggtggatacgctgaagcagaagaagctggag
gagatgactcggacagaacaagaggattcctcctgcatggaaaaactactttcaaaagat
tggaaggaaaaaatggaaagactaaatacgagtgaacttcttggagaaatcaaaggtaca
cctgagagccttgcagagaaagaacggcaactctccaccatgattacccagctgatcagc
ttgcgggagcagctcctggcagcccatgatgaacagaaaaagctggcagcatcgcagatc
gagaaacagcggcagcaaatggaccttgctcgccaacagcaagaacagatcgcaagacaa
cagcagcaacttctacagcagcagcacaagattaatctcctgcagcaacagatccaggtt
caggggcacatgcctccgctcatgatcccaatttttccacatgaccagcggaccttggca
gcagctgctgctgcccaacagggattcctcttcccccctggaataacatacaagccaggt
gataactaccccgtacagttcattccgtcaacaatggcagctgctgctgcttctggactc
agccctttacagcttcagaagggtcatgtttcccacccacaaattaacccaaggctaaag
ggcataagtgaccgttttggcaggaatttggacccctctgaacatggtggtggccactct
tacaaccacagacagattgagcagctctatgccgctcagctggccagcatgcaggtgtca
cctggagcaaagatgccatcaactccacagccaccaaactcggcaggggcagtctcacct
actgggataaaaaatgaaaagagagggaccagccctgtaactcaagttaaggatgaaaca
acagcccagccgctgaatctctcatcccggcctaagacagcagagcctgtgaagtcccca
acatctcccacccagaacctcttcccagccagcaaaaccagccctgtcaacctgccaaac
aaaagcagcatccccagccccattggaggaagcctggggagaggatcctctctagatata
ctatccagtctcaactctcctgccctgtttggggaccaggacacagtgatgaaagccatt
caggaggctcggaagatgcgagaacagatccagcgggagcaacaacagcagccacacgga
gttgatgggaaactgtcctccatgaacaacatggggctgagcaactgcaggactgagaag
gaaagaacacgctttgagaacctgggtccccaattaacaggaaagtcaagtgaagatgga
aaactgggcccgggtgtcatcgatctcactcggccagaggacgcagaaggaagcaaagca
atgaatggctctgcagctaaactacagcagtattattgttggccaacaggaggcgccact
gtggctgaagcccgtgtctacagggatgcccgcggccgtgccagcagcgaaccccacatc
aagcgaccaatgaatgcgttcatggtttgggcaaaggacgaaaggaggaaaattcttcag
gccttccctgacatgcataactccaacattagcaaaatcttaggatctcgctggaaatcc
atgtccaaccaggagaagcaaccttactatgaagaacaggcccggctaagcaaaatccac
ctagagaagtacccaaactacaagtacaaaccccggccgaagcgcacatgcatcgtggat
ggcaagaagctccggattggggagtacaagcaactgatgcgctcgcgaaggcaggagatg
cgacagttcttcactgtggggcaacagcctcagatgcccatcaccacaggaacaggtgtt
gtgtatcctggtgctattactatggcaacgaccacaccatcacctcagatgacatctgac
tgctctagcacctctgccagccccgagcccagcctccctgtcatccagagcacgtatggt
atgaagatggacggcgcaagcctggctgggaacgacatgattaatggagaggatgaaatg
gaagcctatgacgactacgaagatgatcccaaatcagactatagcagcgagaatgaggcc
ccagagcctgtcagtgccaactga

DBGET integrated database retrieval system