KEGG   Mus musculus (mouse): 20684
Entry
20684             CDS       T01002                                 

Symbol
Sp100, A430075G10Rik
Name
(RefSeq) nuclear antigen Sp100
  KO
K15413  nuclear body protein Sp100
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    20684 (Sp100)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    20684 (Sp100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20684 (Sp100)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   SAND domain-containing proteins
    20684 (Sp100)
SSDB
Motif
Pfam: HSR SAND
Other DBs
NCBI-GeneID: 20684
NCBI-ProteinID: NP_001300641
MGI: 109561
Ensembl: ENSMUSG00000026222
Vega: OTTMUSG00000030061
UniProt: O35892 Q8BNW8
Position
1 C5; 1 43.6 cM
AA seq 482 aa
MEGSDGSPRMSTEQENTEMHLIECMLKHFKTQKVAISNAIRSTFPFLESLRDHEFITGKM
YEDLLDSCRSLVPVDKVIYRALEELEKKFDMTVLCELFNEVNMEKYPDLNLIRRSFGCVF
PNELCFQGIDGGNPNSQLSLEQGPGASYSQGSPNGSSLDLSASEGWRSNDRRNSNLMQAN
QTENHQLAESPGHLDSCELQVQLNNRDATPESCSLLPQNEERAVQLNYELQINPCFVQLV
DVKKENSSFSLAGNQQTRARTNQNEDSEIIELSSGDSDNGENFSEATTTVPSQPAPAYSR
KPPTLRRDRGGDTSDTESSIIIRRRKRTGRKKRERLGSYLIRNIKIPMKPSWKTAFLARS
ANPSSQRRRKRGPRIPREENADFGGAELPVVCGNAQGFLDKEKFKQGIYVRSIRGKTGRL
FTPMDFEIEGNCEKAKNWRQSIRCKGWTLRELIQKGVLQDPPRKKKETPRNPRQTRRQVN
AL
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggaagggagcgacggcagccccaggatgtccactgaacaggagaacacagagatgcat
ctcattgaatgtatgttaaagcacttcaagacacagaaagtggccatttctaatgcgata
agaagtacatttccttttcttgagagcctccgagaccatgaattcatcactggtaaaatg
tatgaagatttgctagattcctgtagatcgctggtccctgtggacaaagtgatctacaga
gccctggaggaactggagaagaaatttgacatgacggtactgtgcgaattgttcaatgag
gtcaacatggagaagtaccccgatttgaatctcattcgtagaagctttggatgtgtgttt
cccaatgaattgtgtttccaaggaattgatggagggaacccaaactcccagctaagtctt
gaacaaggacctggtgccagctattctcaaggaagcccgaatgggtcatccttagatctc
tccgcatctgaaggctggagaagtaatgatagaagaaattccaacctcatgcaggcaaac
caaactgagaatcatcagcttgccgaatcaccaggtcaccttgattcctgtgaactccaa
gtccaactgaataacagagatgctaccccagagtcttgcagcctattgcctcagaatgaa
gaaagagctgtgcaactcaactatgaactccagattaatccctgttttgtgcaactggta
gatgtaaagaaggaaaattcatcattttccttggctggtaaccaacaaacccgagcaagg
accaaccaaaatgaggactctgagataatagaactcagcagtggggattctgataatgga
gagaacttctcagaagctacaaccacagtcccctcccagccagcacctgcatattccaga
aaacctccaacactgagaagagacagaggaggagatacttctgacactgagagctctatc
atcattagaagacggaaaaggacaggacggaaaaagagagagagacttggaagctactta
atacggaacatcaaaatcccaatgaaaccaagctggaaaacagctttcctagcaagaagt
gccaatccttcttcacaacgacgcagaaaaagaggtccgagaatccccagagaagaaaat
gcggattttggaggagctgagcttcctgtggtatgtggcaacgctcagggcttcctggat
aaggagaaatttaagcaaggcatctatgtgaggagtatacggggcaagacagggcggtta
ttcactcccatggactttgaaatcgaaggaaactgtgaaaaagccaagaactggcggcaa
agcatccgctgcaagggatggaccctgagagaactgatacagaaaggagtactacaagac
ccaccaaggaaaaagaaggaaactccacgaaacccaaggcaaacaaggagacaggtaaat
gccctgtga

DBGET integrated database retrieval system