KEGG   Mus musculus (mouse): 20686Help
Entry
20686             CDS       T01002                                 

Gene name
Spa17, Sp17
Definition
(RefSeq) sperm autoantigenic protein 17
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RIIa IQ
Motif
Other DBs
NCBI-GeneID: 20686
NCBI-ProteinID: NP_001311474
MGI: 1333778
Ensembl: ENSMUSG00000001948
Vega: OTTMUSG00000063101
UniProt: Q62252 Q545M2
Position
9; 9 A4
AA seq 149 aa AA seqDB search
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDPAEW
GAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQ
SLFRGHVAREEVKKMKSDKNENLKEEADN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcctttctccaacacccactaccgaattccacaaggatttggaaatcttctt
gaagggctgacacgggagattctgagggagcaaccggacaatataccagcttttgccgca
gcgtattttgagaaccttctagagaaaagagagaaaaccagctttgatccagcagaatgg
ggggctaaggtagaggaccgcttctataacaaccacgcattcaaggaacaagaacaagtt
gagaaatgtgaacaagaattagctaagtcatctggaagagaagaaacaccagtcactccc
ttcgaggagtctactgaggaagaaagagaacaggaggaggcggctgctctcaaaatccag
tccctcttccggggacacgtggctagagaagaggtaaagaagatgaagtcagataagaat
gagaatctgaaagaagaggcagacaattga

DBGET integrated database retrieval system