KEGG   Mus musculus (house mouse): 20688
Entry
20688             CDS       T01002                                 
Symbol
Sp4, 5730497N03Rik, HF-1b, HF1-b
Name
(RefSeq) trans-acting transcription factor 4
  KO
K09194  transcription factor Sp4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20688 (Sp4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    20688 (Sp4)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_8
Other DBs
NCBI-GeneID: 20688
NCBI-ProteinID: NP_001159857
MGI: 107595
Ensembl: ENSMUSG00000025323
UniProt: K4DI62 Q6DFV2
Position
12:complement(118195421..118265211)
AA seq 780 aa
MSDQKKEEEEEAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPG
ENQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQPAS
SSSSSSSSNNGSSSPTKTKSGNPSTPNQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQIN
PTSSSSLQDLQGQIQLISAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQ
LQTLPGTQAQVVTTLPINIGGVTLALPVINNVTAGGGTGQVGQPTTTTDSGTSNGNQLVS
TPTTSTAPASTMPESPSSSTTCTTTASTTLTSSDTLVSSADTGQYASTSASSSERTIEEP
QTPAATESEAQSSSQLQSNGIQNAQDQSNSLQQVQIVGQPILQQIQIQQPQQQIIQAIPP
QSFQLQSGQTIQTIQQQPLQNVQLQAVNPTQVLIRAPTLTPSGQISWQTVQVQNIQSLSN
LQVQNAGLSQQLTITPVSSSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVANLG
AAGVQVQGVPVTITSVAGQQQGQDGVKVQQATIAPVTVAVGGIANATIGAVSPDQLTQVH
LQQGQQTSDAEVQPGKRLRRVACSCPNCREGEGSSEPGKKKQHVCHIEGCGKVYGKTSHL
RAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSK
HVKTHQNKKGGGTALAIVTSGELDSSVTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgagcgatcagaagaaggaggaggaggaggaggcggcagcggcgatggctacagaagga
gggaaaacctctgagccagagaataacaataaaaaacccaaaacctcaggctcccaggac
tctcagccctctcctctggctttactggcagctacttgcagcaaaatagggactcctggt
gaaaatcaagcaactggacaacagcagattattatagatccaagccaaggattggtgcaa
cttcagaatcagccacagcagctagaactggtgacgacgcagcttgctggaaacgcttgg
caacttgttgcctccactcctcctgcttcaaaagaaaataacgtttctcagccagcttct
agttcatctagttcttccagcagtaataacgggagttcctctcctacaaaaactaaatca
ggtaatccttccacccctaatcaatttcaagtcatacaagtacaaaacccaagcggtagt
gtacagtaccaagtgatcccccaacttcagacggtggaaggccagcaaattcaaatcaac
ccaactagtagttcatctctacaggatttgcagggtcaaattcagctcatttctgcaggt
aataatcaagctatcctcacggctgctaacaggacagcttctgggaatatccttgctcaa
aacctggcaaatcagacagttccagtacaaattagacctggcgtttcaataccattgcaa
ttgcagacccttcctggtactcaggctcaagttgtaacaaccctaccaattaacattgga
ggagtgactttagctttgccagtaataaataacgtgactgctggaggagggactggacaa
gtcggccagcctactactactactgacagtgggacttccaatgggaatcagttagtttct
acgcccaccaccagcactgctcccgccagtactatgcctgaatcgccctcctcctctact
acctgcacaaccaccgcatcaacaactctgacgagcagtgacacattagtgagctcagca
gatacaggccagtatgcaagcacatcagccagtagttctgaacgcaccattgaagaacca
cagacacctgctgctactgagtctgaagcccagagctccagccagcttcagtccaacgga
attcagaatgcacaagaccagtcaaattcccttcaacaagtacagattgtaggccagcct
atcctgcagcaaatccagatccagcagcctcagcagcagattattcaagctatcccacca
cagtcatttcagctccagtcagggcagacaattcagaccatccagcagcagcctttgcag
aatgttcaacttcaagcagtaaacccgactcaggtacttatcagggctccaactttaaca
ccttcagggcaaatcagctggcaaactgtccaggtccagaatattcaaagtctttcaaat
ttgcaagttcagaatgctgggttatcccagcagttaaccatcaccccagtgtcttcaagt
ggtggcacaactcttgctcagattgctcctgtggctgttgctggtgccccaataactttg
aatactgcccagcttgcatcagtgcctaaccttcagacagtgagcgttgccaacctgggt
gctgcgggtgttcaagttcagggagttccagtaacaatcactagtgttgcaggtcaacag
caaggacaggatggagtgaaagtccaacaagctactatagctcctgtaacggtggcagtt
ggagggattgctaatgcgacaataggtgctgttagtcctgaccaactcacacaagtgcat
ttgcagcaaggccagcagacctctgatgcagaggtgcaacctggcaagaggctccgaaga
gttgcctgctcctgtcctaactgtagggaaggagaaggaagcagtgaaccaggaaagaag
aagcagcatgtttgccacattgaagggtgtgggaaagtatatggcaagacctctcacctc
cgagcacatctccgatggcacactggagaaagaccgttcatatgcaactggatgttttgt
ggcaaaagattcacaaggagcgatgagcttcagagacacagaaggacccacacaggtgaa
aagagatttgaatgtccagagtgttctaaaaggtttatgcggagtgatcacctatccaag
catgtcaaaactcaccagaataagaaaggaggtgggacagctcttgccattgttacctcc
ggagaactggactcatctgttacagaggtgcttggctctccacggattgtcacggttgcc
gccatttcccaagattcgaatccagcaactcccaatgtttcaacaaacatggaagaattc
tga

DBGET integrated database retrieval system