KEGG   Mus musculus (house mouse): 20700
Entry
20700             CDS       T01002                                 
Symbol
Serpina1a, Aat-2, Aat2, Dom1, PI1, Spi1-1, Spi1-3
Name
(RefSeq) serine (or cysteine) peptidase inhibitor, clade A, member 1A
  KO
K03984  alpha-1-antitrypsin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    20700 (Serpina1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20700 (Serpina1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20700 (Serpina1a)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   20700 (Serpina1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   20700 (Serpina1a)
SSDB
Motif
Pfam: Serpin LON_substr_bdg
Other DBs
NCBI-GeneID: 20700
NCBI-ProteinID: NP_033269
MGI: 891971
Ensembl: ENSMUSG00000066366
UniProt: P07758
Position
12:complement(103819554..103829878)
AA seq 413 aa
MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELV
HQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQT
LNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVE
KGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMT
LSGMLHVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRR
LAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTID
ETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFLGKVVDPTHK
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgactccctccatctcatggggtctactgcttctggcaggcctgtgttgcctggtcccc
agctttctggctgaggatgttcaggagacagacacctcccagaaggatcagtccccagcc
tcccatgagatcgctacaaacctgggagactttgcaatcagcctataccgggagctggtc
catcagtccaacacttccaacatcttcttctccccagtgagcattgccacagcctttgct
atgctctccctagggagcaagggtgacactcacacgcagatcctagagggcctgcagttc
aacctcacacaaacatcggaggctgacatccacaagtccttccaacacctcctccaaacc
ctcaacagaccagacagtgagctgcagctgagcacaggcaatggcctctttgtcaacaat
gacctgaagctggtggagaagtttctggaagaggccaagaaccattatcaggcagaagtc
ttctctgtcaactttgcagagtcagaggaggccaagaaagtgattaatgattttgtggag
aagggaacccaaggaaagatagctgaggcggtgaaaaaactggaccaagacacagttttc
gccctggcaaattacattctctttaaaggcaaatggaagaagccattcgatcctgagaac
actgaggaagctgagttccacgtggacgagtccaccacggtgaaggtgcccatgatgacc
ctctcgggcatgcttcatgtgcaccattgcagcacgctgtccagctgggtgctgctgatg
gattatgcaggcaatgccactgctgtcttccttctgcccgatgatgggaagatgcagcat
ctggagcaaactctcagcaaggagctcatctctaagttcctgctaaacaggcgcagaagg
ttagcccagatccacttccccagactgtccatctctggagaatataacttgaagacactc
atgagtccactgggcatcacccggatcttcaacaatggggctgacctctccggaatcaca
gaggaaaatgctcccctgaagctcagccaggctgtgcataaggctgtgctgaccatcgat
gagacaggaacagaagctgcagcagttacagtcttacaaatggttcctatgtctatgccc
cctatcctgcgcttcgaccaccctttccttttcataatatttgaagaacacactcagagc
cccatctttttgggaaaagtggtagatcccacacataaatga

DBGET integrated database retrieval system