KEGG   Mus musculus (mouse): 20701Help
Entry
20701             CDS       T01002                                 

Gene name
Serpina1b, D12Ucla2, Dom2, PI2, Spi1-2
Definition
(RefSeq) serine (or cysteine) preptidase inhibitor, clade A, member 1B
  KO
K03984  alpha-1-antitrypsin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    20701 (Serpina1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20701 (Serpina1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20701 (Serpina1b)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   20701 (Serpina1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   20701 (Serpina1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin LON_substr_bdg Cyt_c_ox_IV
Motif
Other DBs
NCBI-GeneID: 20701
NCBI-ProteinID: NP_033270
MGI: 891970
Ensembl: ENSMUSG00000071178
Vega: OTTMUSG00000035410
UniProt: P22599
Position
12 E; 12 52.98 cM
AA seq 413 aa AA seqDB search
MTPSISWGLLLLAGLCCMVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELV
HQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQT
LNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVE
KGTQGKIVEAVKELDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDKSTTVKVPMMM
LSGMLDVHHCSILSSWVLLMDYAGNASAVFLLPEDGKMQHLEQTLNKELISKILLNRRRR
LVQIHIPRLSISGDYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSKAVHKAVLTID
ETGTEAAAATVFEAVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactccctccatctcatggggtctactgcttctggcaggcctgtgttgcatggttccc
agctttctggctgaggatgttcaggagacagacacctcccagaaggatcagtccccagcc
tcccatgagatcgctacaaacctgggagactttgccatcagcctataccgggagctggtc
catcagtccaacacttccaacatcttcttctccccagtgagcattgccacagcctttgct
atgctctccctagggagcaagggtgacactcacacgcagatcctagagggcctgcagttc
aacctcacacaaacatcggaggctgacatccacaagtccttccaacacctcctccaaacc
ctcaacagaccagacagtgagctgcagctgagcacaggcaatggcctctttgtcaacaat
gacctgaagctggtggagaagtttctggaagaggccaagaaccattatcaggcagaagtc
ttctctgtcaactttgcagagtcagaggaggccaagaaagtgattaatgattttgtggag
aagggaacccaaggaaagatagttgaggcagtgaaagaactggaccaagacacagttttc
gccctggcgaattacattctttttaaaggcaaatggaagaagccattcgatcctgagaac
actgaggaagctgagttccacgtggacaagtccaccacggtgaaggtgcccatgatgatg
ctctcgggcatgcttgatgtgcaccattgcagcatactgtccagctgggtgctgctgatg
gattacgcgggcaacgccagtgctgtcttcctcctgcccgaagatgggaagatgcagcat
ctggagcaaactctcaacaaggagctcatctctaagatcctgctaaacaggcgcagaagg
ttagtccagatccatatccccagactgtccatctctggagactataacttgaagacactc
atgagtccactgggcatcacccggatcttcaacaatggggctgacctctctggaatcaca
gaggagaatgctcccctgaagctcagcaaggctgtgcataaggctgtgctgaccatcgat
gagacaggaacagaagctgcagcagctacagtctttgaagccgttcctatgtctatgccc
cctatcctgcgcttcgaccaccctttcctttttataatatttgaagaacacactcagagc
cccatctttgtgggaaaagtggtagatcccacacataaatga

DBGET integrated database retrieval system