KEGG   Mus musculus (mouse): 20702Help
Entry
20702             CDS       T01002                                 

Gene name
Serpina1c, Pi3, Pi6, Skalp, Spi1-3, Spi1-6, Wap3
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade A, member 1C
  KO
K03984  alpha-1-antitrypsin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    20702 (Serpina1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20702 (Serpina1c)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   20702 (Serpina1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin LON_substr_bdg
Motif
Other DBs
NCBI-GeneID: 20702
NCBI-ProteinID: NP_033271
MGI: 891969
Ensembl: ENSMUSG00000079015
Vega: OTTMUSG00000023935
UniProt: Q00896 A0A0R4J0X5
Position
12 E; 12 52.98 cM
AA seq 413 aa AA seqDB search
MTPSISWGLLLLAGLCCLVPSFLAEDVQETDTSQKDQSPASHEIATNLGDFAISLYRELV
HQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQT
LNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVE
KGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMT
LSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLKRPRR
LAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTMD
ETGTEAAAATVLLAVPYSMPPIVRFDHPFLFIIFEEHTQSPLFVGKVVDPTHK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgactccctccatctcatggggtctactgcttctggcaggcctgtgttgcctggtcccc
agctttctggctgaggatgttcaggagacagacacctcccagaaggatcagtccccagcc
tcccatgagatcgctacaaacctgggagactttgcaatcagcctataccgggagctggtc
catcagtccaacacttccaacatcttcttctccccagtgagcattgccacagcctttgct
atgctctccctagggagcaagggtgacactcacacgcagatcctagagggcctgcagttc
aacctcacacaaacatcggaggctgacatccacaagtccttccaacacctcctccaaacc
ctcaacagaccagacagtgagctgcagctgagcacaggcaatggcctctttgtcaacaat
gacctgaagctggtggagaagtttctggaagaggccaagaaccattatcaggcagaagtc
ttctctgtcaactttgcagagtcagaggaggccaagaaagtgattaatgattttgtggag
aagggaacccaaggaaagatagctgaggcggtgaaaaaactggaccaagacacagttttc
gccctggcaaattacattctctttaaaggcaaatggaagaagccattcgatcctgagaac
actgaggaagctgagttccacgtggacgagtccaccacggtgaaggtgcccatgatgacc
ctctcgggaatgcttgatgtgcaccattgcagcacgctgtccagctgggtgctgctgatg
gattatgcaggcaatgccactgctgtcttccttctgcccgatgatgggaagatgcagcat
ctggagcaaactctcagcaaggagctcatctccaagttcctgctaaagaggcccagaagg
ttagcccagatccacttccccagactgtccatctctggagaatataacttgaagacactc
atgagtccactgggcatcacccggatcttcaacaatggggctgacctctccggaatcaca
gaggagaatgctcccctgaagctcagccaggctgtgcataaggctgtgctgaccatggat
gagacaggaacagaagctgcagcagctacagtcttactagccgttccttattctatgccc
cctatcgtgcgcttcgatcaccctttccttttcataatatttgaagaacacactcagagc
cccctctttgtgggaaaagtggtagatcccacacataaatga

DBGET integrated database retrieval system