KEGG   Mus musculus (house mouse): 20710
Entry
20710             CDS       T01002                                 
Symbol
Serpinb9e, AW540195, NK26, Spi14, ovalbumin
Name
(RefSeq) serine (or cysteine) peptidase inhibitor, clade B, member 9e
  KO
K13963  serpin B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    20710 (Serpinb9e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20710 (Serpinb9e)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   20710 (Serpinb9e)
SSDB
Motif
Pfam: Serpin DUF5898
Other DBs
NCBI-GeneID: 20710
NCBI-ProteinID: NP_035586
MGI: 894672
Ensembl: ENSMUSG00000062342
UniProt: O08806
Position
13:33433591..33444833
AA seq 377 aa
MNTLSQANGTFAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHL
NPDEDVHQGFQLLLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFYHSEIEQL
SFAEAAEESRQHINMWVSKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDS
TKEVPFKINKKETRPVQMMWQEDTFFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDQGVDI
SKVENNLTFEKLTAWTKPEFMNRTELHVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKAD
FSGMSTKENLCLSKFVHKCVVEVNEEGTEAVAASAGKIILFCDGPDPEVFCADHPFLFFI
MHSTTNSILFCGRFSSP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgaatactctgtctcaagccaatggcacctttgccatccatcttttgaaggtgctctgt
caagacaacccttcagaaaatgtgtgttattctcctatgagcatctcctctgctctagcc
atggttctcttgggtgcaaagggagacactgcagtccagatatgtcaggcacttcattta
aacccagatgaagatgtccatcagggcttccagttgcttctccataacctgaacaagcca
aacaaccaaaagtactgccttactatggccaacaggctctttgtagaaaatacttgtgaa
ttacttccaacatttaaaaagtcctgtcttaaattctatcactctgagattgagcagctc
tcttttgccgaagctgcagaggagtccaggcaacacataaacatgtgggtctccaaacag
actaaaggtaaaattccagacttattgtcagaagactcagttgattcacagaccaggcta
attctcgccaatgctttatacttccaaggaacatggtgtaaattctttgaaaaagatagc
accaaggaagtgccctttaagataaataagaaggaaacaaggccagtgcagatgatgtgg
caggaagacacatttttccatgcctatgtgaaggaaatccaggcacaagtgctggtgatg
ccctatgagggcatagatttgaatttcgtggtcctactcccagatcagggtgtggacatc
agcaaggtggaaaacaatctcacctttgagaagttaacagcctggaccaaaccagagttt
atgaatcgcactgagcttcatgtttatcttccaaaatttaaactacaagaggattatgat
atgaattccctattacagcatttgggaatcttggatgtcttcaatggaagcaaagctgac
ttctcaggaatgtctactaaggaaaacctgtgtctgtccaagtttgttcacaagtgtgta
gtagaggtcaatgaagaaggaacagaggctgttgcagcctctgctggcaaaattatactt
ttctgtgatggtcctgatcccgaagttttctgtgctgaccaccccttccttttcttcatc
atgcacagcacaactaacagcatcctgttctgtggcagattctcatctccataa

DBGET integrated database retrieval system