KEGG   Mus musculus (mouse): 207182
Entry
207182            CDS       T01002                                 

Symbol
Ggt7, 1110017C11Rik, 6330563L03Rik, Ggtl3
Name
(RefSeq) gamma-glutamyltransferase 7
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00430  Taurine and hypotaurine metabolism
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    207182 (Ggt7)
   00480 Glutathione metabolism
    207182 (Ggt7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    207182 (Ggt7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     207182 (Ggt7)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     207182 (Ggt7)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   207182 (Ggt7)
SSDB
Motif
Pfam: G_glu_transpept
Other DBs
NCBI-GeneID: 207182
NCBI-ProteinID: NP_659035
MGI: 1913385
Ensembl: ENSMUSG00000027603
Vega: OTTMUSG00000016060
UniProt: Q99JP7
Position
2; 2 H1
AA seq 662 aa
MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDS
FLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATG
VTVALVMQIYFGDPQIFQQGAVVTDASSCTALGMEVLSKQGSSVDAAVAAALCLGIVAPH
SSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKPGLLVGVPGMVKGLH
EAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLDTFLPLGHPPL
PGSLLRRPDLAEVLDILGTSGPAAFYNGGNLTLEMVAEAQHAGGVITEEDFSNYSALTEK
PVCGVYRGHLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALAS
RLGDPVYDSTITESMDDMLSKVEAANFRGHISDSQAAPAPLLPVYELDGAPTAAQVLVMG
PDDFIVAMVSSLNRPFGSGLLTPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPL
SFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDL
QSNLLQVDSEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNTFIIGVKDPRSPDAAGAT
IL
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggcggctgagaacgaggctagccaggagagcgccctaggcgcctactcaccagtggac
tatatgagcatcaccagcttcccgaggctgccggaggacgagccagcgcctgcggcccca
ctgaggggccgtaaggacgaggacgccttcttgggagacccggatactgacccggactcc
ttcctcaagtctgcccggcttcagcggctgccttcgtcgtcatcggagatgggcagccag
gacgggtcaccattacgggagactcgcaaggacccattctcagctgcagcagcagagtgt
tcttgccgccaggatgggctcacggtcattgtcaccgcctgcctcacttttgccaccggt
gtcaccgtggcgctggtcatgcaaatctacttcggggatccccagatcttccagcagggt
gctgtggtgacggatgcctccagttgcacggcgctgggcatggaggtgctcagtaaacag
ggctcttcagtggatgcagctgtggccgcagccttgtgtttggggattgtggctccacac
agttctggcctgggcggtgggggcgtgatgttggtacatgatatccggcggaatgagagc
cacctaattgatttccgggagtctgcacccggggccctcagagaagaggctctgcagaga
tcctgggataccaagcctgggctcttggtgggggtccccggaatggtgaaagggttacat
gaagctcaccagctctatggcaggctgccctggtcccaagtcctggccttcgcagcagct
gtggcccaagatggcttcaacgtgacccatgatctagctcatgccttggctgagcagctg
cctcccaatgcatctgaccgcttcctggatactttcctgccactgggccacccacccttg
cctggctccctgctgcgacggcctgatctcgctgaggtactggatatactcggcacctct
ggccctgctgccttctacaatggtggcaacctcacactggagatggtggctgaggctcag
cacgcaggcggtgtcataaccgaggaggacttcagcaactatagtgctctcacggagaag
cctgtgtgtggagtgtaccgaggccacctggttctcagccccccacccccacacacaggc
ccggccctcatcagtgctctcaacatcctggagggcttcaacctcaccagcctggtgtcc
cgtgagcaagcgcttcactgggtagcagagaccctgaagattgcattggccctggctagc
agactgggagaccctgtctatgattctaccatcactgagagcatggacgacatgctcagc
aaggtggaggccgccaacttccggggccacatcagtgactctcaggcagcccctgcccca
ctcctgcctgtctatgagctggacggggctcccactgctgcccaggtgctggtcatgggc
cctgatgacttcatcgtagccatggtcagctccctgaaccggccttttggaagtggcctc
ctcactccctccgggatccttctcaacagccagatgctagacttctcctggcccaacagg
acagccaaccactctgcacccagcctggagaactcggtacagccagggaagcggcccctc
tctttccttctgcccactgtagtccgaccagcagaagggctctgtgggacctacctcgct
ctgggggccaatggagctgctcgaggcctcagtggcctgacccaggttctactgaatgtc
ctgaccttgaacaggaacctgagtgacagcctggcccgaggacgcctccacccagacctg
cagtccaacctcctgcaggttgacagtgagttcactgaggaagagattgagttcctggaa
gccaggggtcaccacgtggagaaggtagatgtcttatcctgggtccacggcagtcggaga
accaacaccttcatcatcggtgtgaaggaccctcggagcccggatgcagctggagccacc
atcctgtag

DBGET integrated database retrieval system