KEGG   Mus musculus (mouse): 20719
Entry
20719             CDS       T01002                                 

Symbol
Serpinb6a, 4930482L21Rik, D330015H01Rik, PI-6, Serpinb6, Spi3, ovalbumin
Name
(RefSeq) serine (or cysteine) peptidase inhibitor, clade B, member 6a
  KO
K13963  serpin B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    20719 (Serpinb6a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20719 (Serpinb6a)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   20719 (Serpinb6a)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 20719
NCBI-ProteinID: NP_001157590
MGI: 103123
Ensembl: ENSMUSG00000060147
Vega: OTTMUSG00000000739
UniProt: Q60854 Q4FJQ6
Position
13 A3.3; 13 14.0 cM
AA seq 378 aa
MDPLQEANGTFALNLLKILGEDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALD
KCSGNGGGDVHQGFQSLLTEVNKTGTQYLLRTANRLFGDKTCDLLASFKDSCLKFYEAEL
EELDFQGATEESRQHINTWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFN
KEHTREMPFKVSKNEEKPVQMMFKKSTFKMTYIGEIFTKILLLPYVSSELNMIIMLPDEH
VELSTVEKEVTYEKFIEWTRLDKMDEEEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGR
ADFSGMSSKQGLFLSKVVHKAFVEVNEEGTEAAAATAGMMTVRCMRFTPRFCADHPFLFF
IHHVKTNGILFCGRFSSP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggatcctctacaggaagcaaatggcacctttgccttaaaccttttgaaaatactgggt
gaagacagctcaaaaaatgtatttttgtcacccatgagcatatcctcagccctggctatg
gtcttcatgggggcaaaaggaaccactgctagccagatggctcaggcacttgctttggat
aaatgcagcggcaatggaggtggagatgtccaccagggcttccagtcccttctcaccgaa
gtgaacaaaactggcacacagtacttgctcagaacagccaacaggctcttcggggataag
acttgtgatcttttagcgtcttttaaagattcctgcctcaagttctatgaagcagagttg
gaagagctggactttcagggtgctacagaggagtcccgacagcacatcaacacctgggta
gccaaaaagacagaagataaaatcaaagaggtgctgtctccaggtacagtgaattctgat
acatcgctagtccttgtgaatgccatctacttcaaaggaaactgggagaagcagtttaac
aaagagcataccagggagatgccattcaaagtcagcaagaatgaggagaaacctgtgcaa
atgatgtttaagaagtctacctttaagatgacctatattggagagatattcactaagatt
ctgttgcttccctatgtcagcagtgagctgaacatgatcatcatgcttccagatgagcac
gttgaactgagtacagtggaaaaggaagtaacttacgagaaatttatagagtggacaagg
ctggacaagatggacgaagaagaggtagaagtatttctcccaaagtttaagctggaggag
aattacaacatgaacgatgccctctacaagttgggcatgactgatgcctttggcggcagg
gcagacttttctggaatgtcttccaagcaaggcttgtttctgtctaaggttgtgcataag
gcctttgtggaggttaatgaggagggcacagaggctgcagctgctacagctggcatgatg
acggtgaggtgcatgagattcactccccgcttctgtgccgaccaccccttccttttcttc
attcaccatgttaagaccaatggaattctgttctgtggccggttctcctctccctga

DBGET integrated database retrieval system