KEGG   Mus musculus (house mouse): 20720
Entry
20720             CDS       T01002                                 
Symbol
Serpine2, B230326M24Rik, PAI-1, PI-7, PI7, PN-1, Spi4
Name
(RefSeq) serine (or cysteine) peptidase inhibitor, clade E, member 2
  KO
K16643  glia-derived nexin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20720 (Serpine2)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20720 (Serpine2)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   20720 (Serpine2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   20720 (Serpine2)
SSDB
Motif
Pfam: Serpin DUF6750
Other DBs
NCBI-GeneID: 20720
NCBI-ProteinID: NP_033281
MGI: 101780
Ensembl: ENSMUSG00000026249
UniProt: Q07235 Q543R5
Position
1:complement(79772038..79836382)
AA seq 397 aa
MNWHFPFFILTTVTLYSVHSQFNSLSLEELGSNTGIQVFNQIIKSRPHENVVVSPHGIAS
ILGMLQLGADGKTKKQLSTVMRYNVNGVGKVLKKINKAIVSKKNKDIVTVANAVFLRNGF
KMEVPFAVRNKDVFQCEVQNVNFQDPASASESINFWVKNETRGMIDNLLSPNLIDGALTR
LVLVNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQVPMLAQLSVFRSGSTRTPNGLWYN
FIELPYHGESISMLIALPTESSTPLSAIIPHITTKTIDSWMNTMVPKRMQLVLPKFTAVA
QTDLKEPLKALGITEMFEPSKANFTKITRSESLHVSHILQKAKIEVSEDGTKASAATTAI
LIARSSPPWFIVDRPFLFSIRHNPTGAILFLGQVNKP
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaattggcattttcctttcttcatcttgaccacagtgactttatactctgtgcactcc
cagttcaactctctgtcactggaggaactaggctccaacacagggatccaggtcttcaat
cagatcatcaagtcacggcctcatgagaacgttgttgtctccccacatgggatcgcgtcc
atcttgggcatgctgcagctcggggctgacggcaagacaaagaagcagctctccacggtg
atgcgatataatgtaaacggagttggtaaagtgctgaagaagatcaacaaggctattgtc
tccaagaaaaataaagacattgtgaccgtggccaatgctgtgtttctcaggaatggcttt
aaaatggaagtgccttttgcagtaaggaacaaagatgtgtttcagtgtgaagtgcagaat
gtgaacttccaggacccagcctctgcctctgagtccatcaatttttgggtcaaaaatgag
accaggggcatgattgataatctgctttccccaaatctgatcgatggtgcccttaccagg
ctggtcctcgttaatgcagtgtatttcaagggtttgtggaagtctcggtttcaaccagag
agcacaaagaaacggacattcgtggcaggtgatgggaaatcctaccaagtacccatgttg
gctcagctctctgtgttccgctcagggtctaccaggaccccgaatggcttatggtacaac
ttcattgagctgccctaccatggtgagagcatcagcatgctgatcgccctgccaacagag
agctccaccccactgtctgccatcatccctcacatcactaccaagaccattgatagctgg
atgaacaccatggtacccaagaggatgcagctggtcctacccaagttcacagctgtggca
caaacagatctgaaggagccactgaaagcccttggcattactgagatgtttgagccatca
aaggcaaattttacaaaaataacaaggtcagagagccttcatgtctctcacatcttgcaa
aaagcaaaaattgaagtcagtgaagatggaaccaaagcttcggcagcaacaactgcaatc
ctaattgcaaggtcatcacctccctggtttatagtagacaggcctttcctgttttccatc
cgacacaatcccacaggtgccatcttgttcctgggccaggtgaacaagccctga

DBGET integrated database retrieval system