KEGG   Mus musculus (mouse): 20732
Entry
20732             CDS       T01002                                 

Gene name
Spint1, HAI, HAI-1
Definition
(RefSeq) serine protease inhibitor, Kunitz type 1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05202  Transcriptional misregulation in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    20732 (Spint1)
  09162 Cancer: specific types
   05215 Prostate cancer
    20732 (Spint1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20732 (Spint1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   20732 (Spint1)
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a
Other DBs
NCBI-GeneID: 20732
NCBI-ProteinID: NP_058603
MGI: 1338033
Ensembl: ENSMUSG00000027315
Vega: OTTMUSG00000015880
UniProt: Q9R097
Position
2; 2 E5
AA seq 507 aa
MAGRRLARASISAVGVWLLCALGLQATEAELPSAPAELPGGAACLSRFTSGVPSFVLDTE
ASVSNGATFLGSPTARRGWDCVRSCCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQN
FVCKFAPKEGFINYLTQELYRSYRELRTRGFGGSRIPRIWMGIDLKVQLQKPLVLNEADN
TDWHLLQGDSDVRVERKRPEEVELWGLKEGTYLFQLTRTDSDQPEETANLTITVLTAKQT
EDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLACKDVQGI
SPKRHHPVCSGSCHATQFRCSNGCCIDGFLECDDTPDCPDGSDEATCEKYTSGFDELQNI
HFLSDKGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCR
GISKKDVFGLRREGSIPTVGSAEVAIAVFLVICIIVVLTILGYCFFKNQRKEFHSPLHHP
PPTPASSTVSTTEDTEHLVYNHTTQPL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcgggccgccgcctggcgcgggccagcatctctgcggtcggcgtatggctcctttgc
gcgcttggcctccaggccaccgaggccgagctgccgtccgcacccgctgagcttcccggg
ggagccgcctgcttgagccgctttaccagcggggtgccgtcctttgtgctggacaccgaa
gcctcagtcagcaacggggccaccttcctgggttccccgacggcgcgccgcggctgggac
tgcgtgcgctcctgctgcaccactcagaactgcaacctggcgctggtggagctgcagcca
gacggcggcgaggacgccatctctgcctgcttcctcatgaactgcctgtacgagcagaac
ttcgtgtgcaagttcgctccgaaggagggcttcatcaactatcttactcaggagctttac
cgctcctaccgcgagctgcggactcgaggctttggagggtcccggatccctcgaatctgg
atgggcatagacttgaaggtccagctgcagaagcccctggtactgaacgaggcagacaac
acagactggcacctactgcaaggtgacagtgatgtcagagtagagagaaaacgtccggaa
gaagtggagctgtggggacttaaggaggggacctacctgttccaactgacaagaactgac
tcagaccaaccagaggaaacagccaacctgactatcactgtgctaactgccaagcagaca
gaagattattgcctcgcatcctacaaggtgggccgctgccggggctccttcccacgctgg
tactacgaccccaaggaacagatctgcaaaagttttacttttggaggttgcctgggcaac
aagaacaactaccttcgtgaggaagagtgcatgctagcctgcaaggatgtgcaaggaatc
tcaccgaaaaggcaccatccagtgtgctccggcagctgccatgccacccagttccgctgt
agcaatggctgctgtatcgatggcttcctggagtgtgatgacacgccagactgccctgat
ggctccgacgaggccacctgtgaaaaatacaccagcggctttgatgagcttcagaatatc
catttcctcagtgacaaagggtactgtgcagagctgccagacactgggttttgcaaggag
aacatcccacgctggtattacaacccattcagtgaacgctgtgcccgattcacctatggt
ggttgctatgggaacaagaacaactttgaggaggaacagcagtgtcttgagtcctgccgt
ggcatctccaagaaggatgtgtttggtcttcggagggaaggctccattcccactgtaggc
tccgctgaggtagctattgctgtatttctggtcatctgcatcatagtggtcttaaccatc
ctgggctactgtttcttcaagaaccaaagaaaggaattccacagtcccctgcaccaccca
cctcccacaccagccagctccactgtttccaccacagaggacacagagcacctggtctat
aatcacacaacccagcctctctga

DBGET integrated database retrieval system