KEGG   Mus musculus (mouse): 20733
Entry
20733             CDS       T01002                                 

Symbol
Spint2, AL024025, C76321, HAI-2
Name
(RefSeq) serine protease inhibitor, Kunitz type 2
  KO
K23421  Kunitz-type protease inhibitor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    20733 (Spint2)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   20733 (Spint2)
SSDB
Motif
Pfam: Kunitz_BPTI
Other DBs
NCBI-GeneID: 20733
NCBI-ProteinID: NP_035594
MGI: 1338031
Ensembl: ENSMUSG00000074227
Vega: OTTMUSG00000059216
UniProt: Q9WU03 Q9D8Q8
Position
7; 7 B1
AA seq 252 aa
MAQLCELRRGRALLALVASLLLSGAQVASRELDVHESCGVSKVVGKCRASIPRWWYNITD
GSCQPFVYGGCEGNGNNYQSKEECLDKCAGVTENTTDDMARNRNGADSSVLSVPRKQSAE
DLSAEIFNYEEYCVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACM
QHCSGKQMHPFLTPGLKAVILVGLFLMVLILLLGTSMVCLIRVVRRKQERALRTVWSTAD
DKEQLVKNTCVL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcgcagctttgtgagctgcggcggggccgggcgctcctcgccttggtagcttcgctg
ctcctctccggggcccaggtggccagccgagaactagacgtccacgagtcttgtggagtt
tcgaaggtagtggggaaatgccgggcttccatccccaggtggtggtacaatatcactgat
gggtcctgccagccatttgtttatggaggctgtgaaggcaatggcaataactaccagagc
aaggaggagtgtcttgacaagtgtgctggtgtcactgagaacaccactgatgacatggcc
aggaacaggaatggagccgactcttctgtcctgagtgttcccagaaagcagagtgctgag
gacctgtctgctgagatcttcaactatgaagaatactgtgtcccgaaggccgtcactggg
ccgtgccgcgcagccttccctcgctggtactatgacactgaaaagaattcctgtatcagc
ttcatctacggcgggtgcagaggcaacaagaacagttacctctcccaggaagcatgcatg
cagcactgctctggtaagcagatgcatcctttcctgaccccgggcctaaaagcggtgatc
ctggtggggctgttcctcatggttctgatcctcctcctgggaacctctatggtctgcctc
atccgtgtggttcgcagaaagcaggagcgtgcgctgcgcactgtttggagcactgcggat
gacaaggagcagctggtgaagaacacctgtgtcttgtag

DBGET integrated database retrieval system