KEGG   Mus musculus (mouse): 20737Help
Entry
20737             CDS       T01002                                 

Gene name
Spn, A630014B01Rik, Cd43, Galgp, Ly-48, Ly48
Definition
(RefSeq) sialophorin
  KO
K06477  sialophorin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    20737 (Spn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    20737 (Spn)
CD molecules [BR:mmu04090]
 Proteins
  20737 (Spn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: stn_TNFRSF12A DUF2567 SKG6 DUF4366 DUF4381
Motif
Other DBs
NCBI-GeneID: 20737
NCBI-ProteinID: NP_001032899
MGI: 98384
Ensembl: ENSMUSG00000051457
Vega: OTTMUSG00000029411
UniProt: P15702 Q544C5
Position
7 F3; 7 69.35 cM
AA seq 395 aa AA seqDB search
MALHLLLLFGACWVQVASPDSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKE
TISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNV
ASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSS
KTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTR
SPSQESSGMLLVPMLIALVVVLALVALLLLWRQRQKRRTGALTLSGGGKRNGVVDAWAGP
ARVPDEEATTTSGAGGNKGSEVLETEGSGQRPTLTTFFSRRKSRQGSLVLEELKPGSGPN
LKGEEEPLVGSEDEAVETPTSDGPQAKDEAAPQSL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcaccttctcctcctctttggggcatgctgggtccaggtggcgagcccagac
agtctgcagaggacgacgatgctaccatctaccccacatatcacagctccaagtacctct
gaagcccagaatgccagcccatcagtttctgtggggtcagggacagtggactcgaaggag
accatcagcccctgggggcagaccacaatcccagtttctttgacccccttggaaactact
gaattgtcttctttggagacttctgctggtgccagcatgagcacccctgtacctgagcct
actgcctctcaggaagtttccagcaagacatcagcactgcttccagaaccatcaaatgta
gccagtgaccctcctgtcactgcagccaatcctgtgacagacggacctgcagccaatcct
gtgacagacggaactgcagcatctacatctatctctaaaggaaccagtgcaccccccacc
actgtgacaacaagctctaacgagaccagtggaccctctgtggctacaacagtaagctcc
aagaccagtggtccccctgtcaccacagctactgggtctctggggccctcgagtgagatg
catggactccctgctaccacagcaaccagttctgtggagagttccagtgtggcccgtggc
acctcagtttccagcagaaaaacatccacgacgtctacccaagatcccataaccaccagg
tcaccaagccaagaatcaagtggcatgttactggtgcccatgcttattgccttggtggtg
gttttggccctcgtggcgctactgctgttgtggcgccagaggcaaaagcggaggactggg
gccctgaccctgagcggaggaggaaaacgaaatggggtggtggatgcctgggctgggcca
gcccgggttcctgatgaagaggccacaaccacatcaggggcagggggcaacaagggctct
gaggtactggagacagaaggctccgggcagagacccacgctcactacgttcttcagcaga
cggaagtctcgccagggctctttagtactagaagagctgaagcctgggtcgggtcccaac
ctgaagggggaggaagagccgcttgtgggcagtgaggatgaagctgtggaaaccccaact
tctgacggtccacaagccaaagatgaggccgcacctcaatctctatga

DBGET integrated database retrieval system