KEGG   Mus musculus (mouse): 207618Help
Entry
207618            CDS       T01002                                 

Gene name
Zfp804b, Gm441
Definition
(RefSeq) zinc finger protein 804B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_jaz zf-met
Motif
Other DBs
NCBI-GeneID: 207618
NCBI-ProteinID: NP_001156695
MGI: 2685287
Ensembl: ENSMUSG00000092094
Vega: OTTMUSG00000054203
UniProt: A0A0G2JGH6
Position
5; 5 A1
AA seq 1343 aa AA seqDB search
MACYLVISSRHLSNGHYRGIKGVFRGPLCKNGSPSPDFAEKEKSTAKSLEDAKANFYCEL
CDKQYNKHQEFDNHINSYDHAHKQRLKELKHREFARNVASKSWKDEKKQEKALKRLHQLA
ELRQQSECVSGNGPAYKTPRIAMEKQLQQGIFPVKNGRKVSCMKSAVFKGKNVPRSSMDK
ERSAMPNRHQLQSDRRHLFGNMITQTSSDLSNANHRTGVSFSFSKKAYLKLESSASVFSE
NTDDTHDCSKSPTYKVKRTVENCKCGRFASNDADLMKEEAVLSASNLEGFLNTSSMNSKI
SQNKHESINGRLKDAAGTHMAFSKSHFHVSERDCTLSSREKEIRNALKDTSENCINHPCQ
ANESSSPLNIYKHSDSRWCECLDEFLPSGPSEKKTQAHRIPNSRMEARAKSSDESERVGK
NVQRHCREDCPHDLKSKPLPFLRVQSKDGHTTLQWPTELLFFTRTEPCISYGCNPLYFDF
KLSRNTKDECNSENVQTELEKKALEIKTKPESQVTDLIKEQEKLTQDNQSLKPKMSVANL
DWEKFQRKYNLDYNDSDSSVSEHASLRDLEMKSPEVPAYLKLSLKDGLGNNNVDDIELME
PSNIHWQSCKRTVHNNALGGLSFSPHISRTKNHKLNPCSMQSEFEEENQHIWNFSPYTSG
DHSEYGKDRGVSLNTCNINMARRASTSGEPSYERYSPVSPLRAHPRTVDESSRNMSSWRN
TCTSHRSKGSNSSHKLCFCKRECDSVERHTWKHRKHNCLYMADVRLSSNCPQSETQKDKN
GKISDSFKTKKRSKHRDCHCRERYKLGKNQQFSEPKPPGIFHCDSGSQVSIDGNGGKTFN
GQESQHNKLKSYLRQRAYCLNKNNKSQKSLASLHFGDVGKVKCRQCNSSTANYLLRSCRG
GPSEATQSNIAVGEGPSLTAKGLLERVKAKKCQEQSTKFEISSNSCLKEFHTHSQIQCTT
PPGPPCCRRTVLPFSKKRQHIGKRKNEKGNKVHKTSDNDKGKNLQKINSTILTDTECDNY
LSKGINGLVTDSQSLSRKNNQTTKEKSKSSVIEVQPFLQSYDPVPNDFLGAFSSNRYTGV
TDSTETKEDQINLDLEDVSMSVNHVEGNINSYYDRAVQKHDKMEDELEVCHKSLSPPLIQ
QPITFSPDEIDKYRLLQLQAQQHVQKQLLARPLRVLPAAGPTAFSPASAVQTVPVHQHTS
ITTIHHTFLQHFAVSASISSHSSPLPIAHLHPLSQPHFTPISFSTIAPTIIPGHPTFLGH
PLHLVAAAPFHPSHMTLQPLPSAAFIPTLFGPHLNPATTSIFHLNPLIQPVLQGQDLYHH
SCSSQMQQLNSVKEALNMAVHLN
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atggcttgttacctggtcatcagttcgagacatctcagcaatgggcactaccggggcatt
aagggagtcttcagagggcccctctgcaagaatggatctccgtctccggattttgcagaa
aaggagaagtctacagcaaaatctctggaagatgcaaaagcgaacttttactgtgaattg
tgtgacaagcagtataacaaacaccaggagtttgacaatcacattaattcttatgaccac
gctcataagcagagattgaaagaattaaagcatcgtgaatttgctcgaaatgtagcttct
aaatcatggaaagatgagaagaaacaagaaaaagcacttaagcgactccatcagctggct
gagctacggcaacagtctgaatgtgtttctggaaatggaccagcgtacaaaaccccgagg
atagccatggaaaagcagctccagcagggaattttccctgttaagaatggcagaaaggta
tcctgcatgaaaagtgccgttttcaaaggaaagaatgtgcccagaagtagcatggataag
gagcgatcagccatgccaaaccgacaccagctacaatcagataggcggcacttgtttggg
aatatgataacacaaacatcttcagaccttagcaatgcaaaccacagaacaggagtttca
ttttcattttcaaaaaaagcctatctaaaattagaatcctctgcctcagttttcagcgag
aacacagacgatacacatgattgtagcaagtcacccacctataaagtcaaacgaacagtg
gagaactgcaagtgtggccggtttgcaagcaatgatgcagaccttatgaaggaagaagct
gtcctttcagcaagcaatctggagggttttttaaacacctcctcgatgaactctaaaatt
tcacaaaacaaacatgaatctattaatgggagactgaaagatgcagcgggcactcacatg
gctttctctaagtctcacttccatgtttcagagagagattgtactctttccagcagagag
aaagaaattagaaatgcactgaaggatacttcagaaaactgtattaatcacccatgccaa
gcaaatgaatcttccagtccactaaacatttacaagcacagtgatagtaggtggtgtgaa
tgtctggatgagtttttgccttcaggaccaagtgaaaagaagactcaagcacatcgaatt
cctaactcaagaatggaggccagagcaaagtcttcagatgaatcagaaagggttggcaaa
aatgttcaaagacattgcagagaagattgtccacatgatctgaaatccaaaccattgcct
ttcctccgtgtacagagcaaggatggtcacaccactctacagtggcctacagaacttctc
ttctttaccagaacagaaccttgcatatcttatggatgtaatcctttatattttgatttc
aaactgtctcgcaacacaaaagatgagtgtaattcagagaatgtacaaacagagttggag
aagaaggctttagaaattaagacaaaaccagagagccaagtcacagatttaattaaagaa
caagaaaaattgacccaagataatcaatctctgaaaccaaagatgagtgtagctaaccta
gattgggaaaagttccagcgaaaatacaatctggactataatgactctgactctagtgta
agtgaacatgctagtctacgagacttggaaatgaaaagtcctgaagtgcctgcttacctt
aagctgtctctaaaggatggtttaggaaacaataatgttgatgatattgaattgatggaa
ccatcaaacatccactggcaaagttgcaaaaggacagttcacaataatgccctggggggt
ctgtctttctctcctcacatctcaaggactaaaaaccataagctaaatccctgtagtatg
caatcagagtttgaagaagaaaatcaacatatctggaattttagtccttacacatcaggg
gatcacagtgagtatgggaaggatagaggtgtaagcttaaatacctgcaatatcaacatg
gccagaagagcttctacaagtggggagccaagttatgagagatattctccagtgtcacct
ctgagagcccatcccagaactgtggatgaatcttctagaaacatgtccagctggagaaac
acgtgtacaagtcataggtccaaggggagtaacagcagtcataagctctgcttttgtaaa
agagaatgtgactcggttgaaagacacacgtggaaacacagaaagcacaattgcctctac
atggctgatgtgcgtctaagcagcaactgtcctcagtcagaaacacagaaagacaagaat
ggtaaaatatcagattcatttaaaactaaaaaacgatcaaaacacagagactgccactgc
agagaaaggtataaactgggtaaaaatcaacaattttcagagcccaaacccccaggaatt
ttccattgtgattctggctctcaggtttcaattgatggtaatggtgggaaaacctttaat
ggccaggaatctcagcacaacaaattgaaatcttatttgagacagagagcttactgctta
aataaaaacaacaaaagccaaaaatctttagccagccttcactttggtgatgtgggaaaa
gttaagtgcagacaatgtaactcgagcactgccaactaccttctaaggagctgtagaggt
ggcccttcagaagccacacagtcaaacattgctgttggagaagggccatcccttactgcc
aagggtcttttggaaagagtgaaagccaagaagtgtcaggagcaatcaacgaagttcgaa
atctcctcaaacagttgtttaaaagaatttcacactcattcacaaattcaatgcacaaca
ccacctggaccaccatgctgtaggagaacggtattgcctttttcaaagaagagacaacac
ataggcaaaagaaaaaatgagaaaggtaacaaggttcataaaacttctgataatgacaaa
ggcaaaaacttacaaaaaattaattcaactattttgacagacactgaatgtgacaactat
ctttccaaaggcataaatggtttagtgactgactctcagtctttaagcagaaaaaataac
cagacaacaaaagagaaatctaaatcttcagttattgaagtccaaccttttcttcaaagc
tatgacccagtaccaaatgatttccttggtgctttttcgtctaatagatatactggcgta
actgattccacagagaccaaagaggaccagataaatctagacttagaggatgtaagcatg
tctgtaaatcatgtagaggggaatataaactcttactatgacagagctgtgcagaagcat
gacaaaatggaagatgaattagaagtgtgtcataaatctctgtcaccccctttaatccaa
cagcccataacgttttctcctgatgagatagataagtacaggctgctccagctccaagcc
cagcagcacgtgcagaagcagctcctggcgaggcctctccgagtgttgcctgctgcaggg
cccactgccttctctcctgcctcagctgtgcagacagttccagtgcaccagcacacatcc
atcaccaccatccaccacacatttctacagcattttgctgtttctgcttccataagttct
cacagcagtcccctccctatagctcatctccatcctctgtcccagccacattttactcct
atttcattttcaaccattgctccaaccattatccctggacaccctactttcctgggtcat
cctctacatttagtcgcagctgcgcccttccacccatcacatatgacattgcagcccctg
ccttctgcggcatttattcccacattgtttggtcctcatttaaacccagccaccacttct
attttccacttgaatcctttaatccaaccagtgctgcaaggtcaagatctttaccatcac
tcttgctccagccagatgcaacagttaaatagtgtgaaggaggctttaaatatggcagta
cacttgaactaa

DBGET integrated database retrieval system