KEGG   Mus musculus (mouse): 20768Help
Entry
20768             CDS       T01002                                 

Gene name
Sephs2, Sps2, Ysg3
Definition
(RefSeq) selenophosphate synthetase 2
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00450  Selenocompound metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    20768 (Sephs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    20768 (Sephs2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     20768 (Sephs2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    20768 (Sephs2)
 Prokaryotic type
    20768 (Sephs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 20768
NCBI-ProteinID: NP_033292
MGI: 108388
Ensembl: ENSMUSG00000049091
Vega: OTTMUSG00000058499
UniProt: P97364
Position
7 F3; 7 69.43 cM
AA seq 452 aa AA seqDB search
MAEAAAAGASGETMAALVAAEGSLGPAGWSAGRSFSNYRPFEPQTLGFSPSWRLTSFSGM
KGUGCKVPQETLLKLLEGLTRPALQPPLTSGLVGGQEETVQEGGLSTRPGPGSAFPSLSI
GMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLL
SVSQSMSEKEREKVTPLMIKGFRDAAEEGGTAVTGGQTVVNPWIIIGGVATVVCQQNEFI
MPDSAVVGDVLVLTKPLGTQVAANAHQWLDNPEKWNKIKMVVSREEVELAYQEAMFNMAT
LNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQKNEVSFVIHNLPIIAKMAAISKAS
GRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARII
DKPRVIEVLPRGASAAAAAAPDNSNAASEPSS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcggcggcggcgggcgccagcggagaaaccatggcggcgctagtggccgca
gaaggttccttgggcccggcgggctggtctgccggccggagtttctccaactaccggccg
ttcgagccccagacactgggcttcagcccgagctggcggctgacgagcttctccggcatg
aagggctgaggctgcaaggtcccccaggagaccctgctcaaactcctggagggactgacg
cggcccgcgctgcagcccccgcttacctcgggtctggtcgggggccaggaagagacggtg
caggaagggggcctgtccaccaggcccggccccggctcagccttcccctcgctgagcatt
ggcatggactcctgcgtcatccccctgaggcacggaggcctgtcgctggtgcagaccacc
gacttcttttaccccttggtggaagatccctatatgatggggcgcatagcttgtgccaat
gtgctcagtgacctctatgccatgggtatcactgagtgtgacaacatgttgatgttactc
agtgtgagccagagcatgagtgaaaaggaacgagagaaggtgacaccgctcatgatcaaa
ggctttcgtgacgctgcggaggagggaggcactgcagtgaccggtggacagacagtggtc
aacccgtggattatcatcggtggcgttgccacggtggtgtgtcagcaaaatgaattcata
atgcctgatagtgccgtggtaggagatgtgctggtattaaccaaacctttaggaacccag
gttgctgccaatgcccaccaatggctggataatcctgagaaatggaataaaatcaagatg
gtggtttccagagaggaagtagagttagcctatcaggaagctatgttcaatatggctact
ctaaacaggactgctgctggcttgatgcacacttttaatgcccacgcagccacggatatc
acaggctttggcatattaggacactctcagaacctggcaaaacagcaaaaaaatgaagtg
tcctttgtcatacataatctgccaataattgccaagatggctgcgatcagcaaagccagt
gggcgctttggcctcctccaaggaacgtcagctgaaacctctgggggattactgatttgt
ctgccaagagagcaggcggcccgcttttgttcggaaatcaaatcttccaagtacggagag
ggtcaccaagcttggatcgttggcatcgtggagaagggaaaccggacagcccggatcatt
gacaagcctcgcgttattgaagttctacctcggggagcctctgctgctgctgctgctgct
cctgataattccaacgcagcctctgagcctagttcttga

DBGET integrated database retrieval system