KEGG   Mus musculus (house mouse): 20775
Entry
20775             CDS       T01002                                 
Symbol
Sqle
Name
(RefSeq) squalene epoxidase
  KO
K00511  squalene monooxygenase [EC:1.14.14.17]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00100  Steroid biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    20775 (Sqle)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.17  squalene monooxygenase
     20775 (Sqle)
SSDB
Motif
Pfam: SE FAD_binding_3 DAO NAD_binding_8 Pyr_redox FAD_binding_2 Trp_halogenase Pyr_redox_2 TrkA_N ApbA NAD_Gly3P_dh_N Sacchrp_dh_NADP 3HCDH_N Thi4 FAD_oxidored Shikimate_DH AlaDh_PNT_C F420_oxidored NAD_binding_2
Other DBs
NCBI-GeneID: 20775
NCBI-ProteinID: NP_033296
MGI: 109296
Ensembl: ENSMUSG00000022351
UniProt: P52019 Q3TQK8
Position
15:59186941..59203042
AA seq 572 aa
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRHGGLLGRHQSGA
QFAAFSDILSALPLIGFFWAKSPESEKKEQLESKKCRKEIGLSETTLTGAATSVSTSFVT
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGELLQPGGYRVLQELGLGD
TVEGLNAHHIHGYIVHDYESRSEVQIPYPLSETNQVQSGIAFHHGRFIMSLRKAAMAEPN
VKFIEGVVLQLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKSLISSKVSV
SSHFVGFLMKDAPQFKPNFAELVLVNPSPVLIYQISSSETRVLVDIRGELPRNLREYMAE
QIYPQLPEHLKESFLEASQNGRLRTMPASFLPPSSVNKRGVLILGDAYNLRHPLTGGGMT
VALKDIKLWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRTHSFVVNVLAQALYELFSATDD
SLHQLRKACFLYFKLGGECVTGPVGLLSILSPHPLVLIRHFFSVAIYATYFCFKSEPWAT
KPRALFSSGAVLYKACSILFPLIYSEMKYLVH
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtggacttttcttggcattgctaccttcacctatttttataagaaatgcggggatgtc
accctggccaacaaggagctcctgctgtgcgtgctggtgttcctgtcgctgggcctggtg
ctctcctaccgctgtcgccatcgacacgggggcctccttggccgccatcagagcggcgcc
cagttcgctgccttctcggatattctctctgctttgcctcttattggcttcttctgggcc
aagtcacctgaatcagaaaagaaagaacagctggagtccaagaagtgcagaaaagaaatc
ggtctttcagaaacgacattaacaggagcagctacctcagtgtcgacctcgttcgtgacg
gacccggaagtgatcatcgtgggatctggtgtgcttggatctgccttggcagcagttctc
tccagagatggaagaaaggtgacggtcatcgagagagatttaaaagagcccgacaggata
gttggggagctgctgcagccaggaggctaccgtgttctccaggagctgggccttggagat
acagtagaaggtctcaatgcccatcatatacatggctacatagttcatgactatgaaagc
agatctgaagttcaaattccgtacccactgtcagaaaccaaccaagtgcagagtggaatt
gcttttcaccatggccgattcatcatgagtctccggaaagcagctatggcagagcccaat
gtaaagtttatagaaggtgttgtgcttcagttactagaggaagatgatgctgtaatcggc
gtgcaatacaaggacaaggagactggggacaccaaggagctccacgccccgctcaccgtt
gttgcggatggactcttctccaagttcaggaagagcctcatctccagtaaagtctccgtt
tcttcccacttcgttggcttccttatgaaggatgcaccacagtttaaacccaattttgcg
gagcttgttctggtcaaccccagtccagttctcatctaccagatttcttccagtgaaact
agggtacttgttgatattcggggagaattgccaagaaacctaagagaatacatggctgaa
caaatttacccacagttacctgagcacctgaaggagtcatttctggaggcctctcagaat
ggtcgtctgcggaccatgccggccagcttccttcctccttcctcagtgaacaaacgaggc
gtccttattctgggagatgcgtataacctgaggcaccctcttactggtggaggaatgaca
gttgctttaaaagatataaaattgtggagacaactgttaaaagacattcctgacctttat
gatgatgctgctattttccaggccaaaaaatcattcttttggtcaagaaaaaggacccat
tcctttgttgtgaatgtattggctcaggccttgtatgaattattttcagctacagatgat
tccttgcatcagctccgaaaagcttgctttctgtattttaaacttggtggagagtgtgtg
accggtcctgttgggttgctttcaatattgtctcctcaccctctggtgttgattcgacac
ttcttttccgttgcaatctacgccacgtatttctgcttcaaatcagagccgtgggctaca
aaaccacgggcccttttcagtagcggtgctgtactgtacaaagcgtgttctatcctattt
ccactcatctattcagaaatgaagtatctggttcattga

DBGET integrated database retrieval system