KEGG   Mus musculus (mouse): 20778
Entry
20778             CDS       T01002                                 

Gene name
Scarb1, AI120173, CD36, Cd36l, Cd36l1, Chohd, Chohd1, Cla, Cla-1, Cla1, D5Ertd460, D5Ertd460e, Hdlq, Hdlq1, Hlb39, Hlb398, S, SR-B1, SR-BI, SRBI, Sr, Srb1, mSR-BI
Definition
(RefSeq) scavenger receptor class B, member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04913  Ovarian steroidogenesis
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
mmu04975  Fat digestion and absorption
mmu04976  Bile secretion
mmu04977  Vitamin digestion and absorption
mmu04979  Cholesterol metabolism
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    20778 (Scarb1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    20778 (Scarb1)
   04925 Aldosterone synthesis and secretion
    20778 (Scarb1)
   04927 Cortisol synthesis and secretion
    20778 (Scarb1)
  09154 Digestive system
   04976 Bile secretion
    20778 (Scarb1)
   04975 Fat digestion and absorption
    20778 (Scarb1)
   04979 Cholesterol metabolism
    20778 (Scarb1)
   04977 Vitamin digestion and absorption
    20778 (Scarb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    20778 (Scarb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    20778 (Scarb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20778 (Scarb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    20778 (Scarb1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    20778 (Scarb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   20778 (Scarb1)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 20778
NCBI-ProteinID: NP_058021
MGI: 893578
Ensembl: ENSMUSG00000037936
Vega: OTTMUSG00000022742
UniProt: Q61009
Structure
PDB: 
5KTF

Position
5 64.11 cM; 5 G1.1
AA seq 509 aa
MGGSSRARWVALGLGALGLLFAALGVVMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIP
VPFYLSVYFFEVVNPNEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSFVENRSLH
FQPDKSHGSESDYIVLPNILVLGGSILMESKPVSLKLMMTLALVTMGQRAFMNRTVGEIL
WGYDDPFVHFLNTYLPDMLPIKGKFGLFVGMNNSNSGVFTVFTGVQNFSRIHLVDKWNGL
SKIDYWHSEQCNMINGTSGQMWAPFMTPESSLEFFSPEACRSMKLTYNESRVFEGIPTYR
FTAPDTLFANGSVYPPNEGFCPCRESGIQNVSTCRFGAPLFLSHPHFYNADPVLSEAVLG
LNPNPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGIGQTGKIEPVVLPLLWFEQSG
AMGGKPLSTFYTQLVLMPQVLHYAQYVLLGLGGLLLLVPIICQLRSQEKCFLFWSGSKKG
SQDKEAIQAYSESLMSPAAKGTVLQEAKL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggcggcagctccagggcgcgctgggtggccttggggttgggcgccctggggctgctg
tttgctgcgctcggcgttgtcatgatcctcatggtgccctccctcatcaagcagcaggtg
ctcaagaatgtccgcatagacccgagcagcctgtccttcgggatgtggaaggagatcccc
gtccctttctacttgtctgtctacttcttcgaagtggtcaacccaaacgaggtcctcaac
ggccagaagccagtagtccgggagcgtggaccctatgtctacagggagttcagacaaaag
gtcaacatcaccttcaatgacaacgacaccgtgtccttcgtggagaaccgcagcctccat
ttccagcctgacaagtcgcatggctcagagagtgactacattgtactgcctaacatcttg
gtcctggggggctcgatattgatggagagcaagcctgtgagcctgaagctgatgatgacc
ttggcgctggtcaccatgggccagcgtgcttttatgaaccgcacagttggtgagatcctg
tggggctatgacgatcccttcgtgcattttctcaacacgtacctcccagacatgcttccc
ataaagggcaaatttggcctgtttgttgggatgaacaactcgaattctggggtcttcact
gtcttcacgggcgtccagaatttcagcaggatccatctggtggacaaatggaacggactc
agcaagatcgattattggcattcagagcagtgtaacatgatcaatgggacttccgggcag
atgtgggcacccttcatgacacccgaatcctcgctggaattcttcagcccggaggcatgc
aggtccatgaagctgacctacaacgaatcaagggtgtttgaaggcattcccacgtatcgc
ttcacggcccccgatactctgtttgccaacgggtccgtctacccacccaacgaaggcttc
tgcccatgccgagagtctggcattcagaatgtcagcacctgcaggtttggtgcgcctctg
tttctctcccacccccacttttacaacgccgaccctgtgttgtcagaagctgttcttggt
ctgaaccctaacccaaaggagcattccttgttcctagacatccatccggtcactgggatc
cccatgaactgttctgtgaagatgcagctgagcctctacatcaaatctgtcaagggcatc
gggcaaacagggaagatcgagccagtagttctgccgttgctgtggttcgaacagagcgga
gcaatgggtggcaagcccctgagcacgttctacacgcagctggtgctgatgccccaggtt
cttcactacgcgcagtatgtgctgctggggcttggaggcctcctgttgctggtgcccatc
atctgccaactgcgcagccaggagaaatgctttttgttttggagtggtagtaaaaagggc
tcccaggataaggaggccattcaggcctactctgagtccctgatgtcaccagctgccaag
ggcacggtgctgcaagaagccaagctatag

DBGET integrated database retrieval system