KEGG   Mus musculus (mouse): 207839
Entry
207839            CDS       T01002                                 

Symbol
Galnt6, 4632410F13, AW047994, GalNA, GalNAc-T6
Name
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 6
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00512  Mucin type O-glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    207839 (Galnt6)
   00514 Other types of O-glycan biosynthesis
    207839 (Galnt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    207839 (Galnt6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     207839 (Galnt6)
Glycosyltransferases [BR:mmu01003]
 O-Glycan biosynthesis
  Mucin-type
   207839 (Galnt6)
SSDB
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_transf_7C Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 207839
NCBI-ProteinID: NP_001155239
MGI: 1891640
Ensembl: ENSMUSG00000037280
Vega: OTTMUSG00000035000
UniProt: Q8C7U7
Position
15; 15 F1
AA seq 622 aa
MRLLRRRHMSLRLAMLGSVFMLFLFIRQKDVSNQEQAMEKPWLKSLAGQKDQVLDFMLGA
VNNIRDVMPKLQIRAPEPPQTLVSTNHSCLPGFYTPAELKPFWDRPPQDPNSPGADGKAF
QKKEWTNLETKEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLPTTS
VIIVFHNEAWSTLLRTVYSVLHTSPAILLKEIILVDDASTDEHLKERLEQYVQQLQIVRV
VRQRERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTAVVSPDIVT
IDLNTFQFSRPVQRGKAHSRGNFDWSLTFGWEMLPEHEKQRRKDETYPIKSPTFAGGLFS
ISKAYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDDYKKIFYRRNLQAAKMVQENNFGDISERLRLREQLRCHNFSWY
LHNVYPEMFVPDLNPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYVCHNLGGNQYFEYTS
QRDLRHNIGKQLCLHASGSTLGLRSCQFVGKNSRVPKDEEWELTQDQLIRNSGSGTCLTS
QDKKPAMAPCNPRDPYQLWLFV
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaggttgctacgaaggcgccacatgtccctgcgcctcgccatgctgggcagcgtcttc
atgctcttcctcttcattcggcagaaggatgtaagcaaccaggagcaggccatggagaaa
ccgtggctgaagtccctggctggccagaaggaccaggtcctggacttcatgctaggtgct
gtgaacaacattagggacgtcatgcctaagctgcagatccgggctccagaaccgcctcag
actctggtctccacaaaccactcctgcctgcccgggttctacacccctgctgagctgaaa
cccttctgggaccggccacctcaagatcccaacagccctggggcagatggaaaagcattt
cagaagaaagaatggaccaatctagagaccaaagaaaaggaagaaggctataagaaacac
tgctttaatgcatttgccagtgaccgcatctccttgcagaggtccctggggccagacacc
cggcctcctgagtgtgttgaccagaagttccggcgctgcccgccactgcccaccaccagc
gtgatcattgtgttccacaacgaagcctggtccactctgctgcgcacagtatacagcgtc
ctgcacaccagccctgccatcttgctgaaggaaatcatcctcgtggatgacgccagcaca
gatgagcacctgaaggagaggctggagcagtacgttcagcagctgcagatcgtgcgcgtg
gttcggcagcgggagcggaaggggctcatcacagccaggctgctgggggccagcgtggcg
caggcagaggtgctcacgttcctggacgcccactgtgagtgttttcacggctggctggag
cccctcctggctcgaattgctgaagacaagacagcggtggtgagcccagacatcgtcacc
atcgaccttaataccttccaattctccagaccagtacagagaggcaaagcccacagccgg
ggcaacttcgactggagcctgaccttcggctgggaaatgcttcctgagcacgagaagcag
agacgcaaggatgagacctaccccatcaagtccccgacgtttgccggcggcctcttctcc
atctccaaggcctactttgagcacatcggtacctatgataaccagatggagatctgggga
ggggagaatgtggaaatgtccttccgggtgtggcagtgtgggggccagctggaaataatc
ccctgctcggtggtcggccacgtgttccgtaccaagagtccccacaccttccccaagggc
accagtgtcattgcgcgcaatcaggtgcgcctggctgaggtctggatggacgactataag
aagattttctacaggagaaatctgcaggcagcaaagatggtccaggagaacaacttcggt
gacatctcggagcgacttcggctcagggagcagctacgatgccacaacttctcctggtac
ctgcacaatgtctacccagagatgtttgtccccgacctgaaccccaccttctatggagcc
atcaagaatcttggcaccaatcagtgtttggacgtgggcgagaacaaccggggaggaaag
cctctcatcatgtatgtctgccacaacctcggcggcaatcagtactttgagtacacatca
cagagggacctccgccacaacattggaaagcagctgtgtctacatgccagtgggagcacg
ctcggccttaggagctgtcagttcgttggcaaaaacagcagagtgcccaaggacgaggag
tgggaattgacccaggatcaactcatcagaaactcaggatctggtacctgcctgacatcc
caggacaaaaagccagccatggccccctgtaatcccagggatccctaccagctctggctg
tttgtctag

DBGET integrated database retrieval system