KEGG   Mus musculus (house mouse): 207854
Entry
207854            CDS       T01002                                 
Symbol
Fmr1nb, 3830422N12Rik, NY-SAR-35, NYSAR35
Name
(RefSeq) Fmr1 neighbor
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TMEM100
Other DBs
NCBI-GeneID: 207854
NCBI-ProteinID: NP_778158
MGI: 2672032
Ensembl: ENSMUSG00000062170
UniProt: Q80ZA7 B7ZNB2
Position
X:67805445..67848167
AA seq 238 aa
MPSDRRPSQRRNRSKSRDYRGARSKVTRADTRNRDDTLALSMYQGPPSADQGNNMADAPR
FGFWTSVSQCLQYLWARRHLGLLLLLFWTLVILFRPVNTAKLPILAEAAELEPPLGNMLD
FFFPTTCIIRDNQVVVACNNQPYLSESECLKSKCCSSTSGTIIKCYAPVRDKPTQVLRVF
GLAAISILVLGFLPMCCCSMCWRRKRMNRMLKVLKKQKSKGKKPKGRKASEERALLSH
NT seq 717 nt   +upstreamnt  +downstreamnt
atgccttcggatcgaaggccaagtcagagaaggaatagatctaagagccgtgattatcgt
ggtgcacggtcaaaggtaacaagagctgatacgaggaacagagacgatactcttgccctc
agtatgtatcaggggcctccgagtgccgaccaggggaacaacatggcggatgcccctcgg
tttggcttctggacttcagtaagccagtgtctgcaatacttgtgggccaggaggcacttg
ggcctgcttctacttttattctggacgctggtgatcctgttccgtcctgtgaacactgcg
aaattgcccattcttgctgaagctgcagaacttgaaccccctttgggaaatatgttggac
tttttctttccaacaacctgcatcataagggacaaccaggtggtggtggcatgtaataac
cagccgtatcttagcgagagtgaatgtttaaaatccaagtgctgttcttcaacatctggg
actataatcaaatgctatgccccagtaagggacaagcctacacaggtgctacgggtgttt
ggccttgctgcgatcagcattctagtcctgggatttctgcctatgtgctgctgctccatg
tgctggaggaggaagaggatgaacaggatgttgaaggttttgaagaaacagaaatcaaaa
gggaagaagcctaaaggaaggaaggcgtcagaagagagagctttactgtcccattga

DBGET integrated database retrieval system