KEGG   Mus musculus (mouse): 20787
Entry
20787             CDS       T01002                                 

Symbol
Srebf1, ADD1, SREBP1, bHLHd1
Name
(RefSeq) sterol regulatory element binding transcription factor 1
  KO
K07197  sterol regulatory element-binding transcription factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    20787 (Srebf1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    20787 (Srebf1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    20787 (Srebf1)
   04932 Non-alcoholic fatty liver disease
    20787 (Srebf1)
   04931 Insulin resistance
    20787 (Srebf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20787 (Srebf1)
   04131 Membrane trafficking [BR:mmu04131]
    20787 (Srebf1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    20787 (Srebf1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    20787 (Srebf1)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 20787
NCBI-ProteinID: NP_035610
MGI: 107606
Ensembl: ENSMUSG00000020538
Vega: OTTMUSG00000005809
UniProt: Q9WTN3
Position
11; 11 B2
AA seq 1134 aa
MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG
PSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGI
KEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQP
PSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKA
DSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH
RLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA
IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP
PPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLAL
CVLAFLCLTCNPLASLFGWGILTPSDATGTHRSSGRSMLEAESRDGSNWTQWLLPPLVWL
ANGLLVLACLALLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGDFPQAAQQLWLALQA
LGRPLPTSNLDLACSLLWNLIRHLLQRLWVGRWLAGQAGGLLRDRGLRKDARASARDAAV
VYHKLHQLHAMGKYTGGHLAASNLALSALNLAECAGDAISMATLAEIYVAAALRVKTSLP
RALHFLTRFFLSSARQACLAQSGSVPLAMQWLCHPVGHRFFVDGDWAVHGAPPESLYSVA
GNPVDPLAQVTRLFREHLLERALNCIAQPSPGAADGDREFSDALGYLQLLNSCSDAAGAP
ACSFSVSSSMAATTGPDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVEHIPQVLQDTER
PLPRAALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTPTGSSIDKAMQLLL
CDLLLVARTSLWQRQQSPASVQVAHGTSNGPQASALELRGFQHDLSSLRRLAQSFRPAMR
RVFLHEATARLMAGASPARTHQLLDRSLRRRAGSSGKGGTTAELEPRPTWREHTEALLLA
SCYLPPAFLSAPGQRMSMLAEAARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS
NT seq 3405 nt   +upstreamnt  +downstreamnt
atggacgagctggccttcggtgaggcggctctggaacagacactggccgagatgtgcgaa
ctggacacagcggttttgaacgacatcgaagacatgctccagctcatcaacaaccaagac
agtgacttcccgggcctgtttgacgccccctatgctgggggtgagacaggggacacaggc
cccagcagcccaggtgccaactctcctgagagcttctcttctgcttctctggcctcctct
ctggaagccttcctgggaggacccaaggtgacacctgcacccttgtcccctccaccatcg
gcacccgctgctttaaagatgtacccgtccgtgtcccccttttcccctgggcctgggatc
aaagaggagccagtgccactcaccatcctacagcctgcagcgccacagccgtcaccgggg
accctcctgcctccgagcttccccgcaccacccgtacagctcagccctgcgcccgtgctg
ggttactcgagcctgccttcaggcttctcagggacccttccaggaaacactcagcagcca
ccatctagcctgccgctggcccctgcaccaggagtcttgcccacccctgccctgcacacc
caggtccaaagcttggcctcccagcagccgctgccagcctcagcagcccctagaacaaac
actgtgacctcacaggtccagcaggtcccagttgtactgcagccacacttcatcaaggca
gactcactgctgctgacagctgtgaagacagatgcaggagccaccgtgaagactgcaggc
atcagcaccctggctcctggcacagccgtgcaggcaggtcccctgcagaccctggtgagt
ggagggaccatcttggccacagtacctttggttgtggacacagacaaactgcccatccac
cgactcgcagctggcagcaaggccctaggctcagctcagagccgtggtgagaagcgcaca
gcccacaatgccattgagaagcgctaccggtcttctatcaatgacaagattgtggagctc
aaagacctggtggtgggcactgaagcaaagctgaataaatctgctgtcttgcgcaaggcc
atcgactacatccgcttcttgcagcacagcaaccagaagctcaagcaggagaacctgacc
ctacgaagtgcacacaaaagcaaatcactgaaggacctggtgtcagcttgtggcagtgga
ggaggcacagatgtgtctatggagggcatgaaacccgaagtggtggagacgcttacccct
ccaccctcagacgccggctcaccctcccagagtagccccttgtcttttggcagcagagct
agcagcagtggtggtagtgactctgagcccgacagtccagcctttgaggatagccaggtc
aaagcccagcggctgccttcacacagccgaggcatgctggaccgctcccgcctggccctg
tgtgtactggcctttctgtgtctgacctgcaatcctttggcctcgcttttcggctggggc
attctcactccctctgatgctacgggtacacaccgtagttctgggcgcagcatgctggag
gcagagagcagagatggctctaattggacccagtggttgctgccacccctagtctggctg
gccaatggactactagtgttggcctgcttggctcttctctttgtctatggggaacctgtg
actaggccacactctggcccggctgtacacttctggagacatcgcaaacaagctgacctg
gatttggcccggggagatttcccccaggctgctcaacagctgtggctggccctgcaagcg
ctgggccggcccctgcccacctcaaacctggatctggcctgcagtctgctttggaacctc
atccgccacctgctccagcgtctctgggtgggccgctggctggcaggccaggccgggggc
ctgctgagggaccgtgggctgaggaaggatgcccgtgccagtgcccgggatgcggctgtt
gtctaccataagctgcaccagctgcatgccatgggcaagtacacaggaggacatcttgct
gcttctaacctggcactaagtgccctcaacctggctgagtgcgcaggagatgctatctcc
atggcaacactggcagagatctatgtggcagcggccctgagggtcaaaaccagcctccca
agagccctgcacttcttgacacgtttcttcctgagcagcgcccgccaggcctgcctagca
cagagcggctcggtgcctcttgccatgcagtggctctgccaccctgtaggtcaccgtttc
tttgtggacggggactgggccgtgcacggtgcccccccggagagcctgtacagcgtggct
gggaacccagtggatccgctggcccaggtgacccggctattccgtgaacatctcctagag
cgagcgttgaactgtattgctcagcccagcccaggggcagctgacggagacagggagttc
tcagatgcccttggatatctgcagttgctaaatagctgttctgatgctgccggggctcct
gcttgcagtttctctgtcagctccagcatggctgccaccactggcccagacccagtggcc
aagtggtgggcctcactgacagctgtggtgatccactggctgaggcgggatgaagaggca
gctgagcgcttgtacccactggtagagcatatcccccaggtgctgcaggacactgagaga
cccctgcccagggcagctctgtactccttcaaggctgcccgggctctgctggaccacaga
aaggtggaatctagcccagccagcctggccatctgtgagaaggccagtgggtacctgcgg
gacagcttagcctctacaccaactggcagttccattgacaaggccatgcagctgctcctg
tgtgatctacttcttgtggcccgtaccagtctgtggcagcggcagcagtcaccagcttca
gtccaggtagctcacggtaccagcaatggaccccaggcctctgctctggagctgcgtggt
ttccaacatgacctgagcagcctgcggcggttggcacagagcttccggcctgctatgagg
agggtattcctacatgaggccacagctcggctgatggcaggagcaagtcctgcccggaca
caccagctcctggatcgcagtctgaggaggagggcaggttccagtggcaaaggaggcact
acagctgagctggagccacggcccacatggcgggagcacaccgaggccctgctgttggca
tcctgctatctgccccctgccttcctgtcggctcctgggcagcgaatgagcatgctggcc
gaggcggcacgcaccgtagagaagcttggcgatcaccggctactgctggactgccagcag
atgctcctgcgcctgggcggcggaaccaccgtcacttccagctag

DBGET integrated database retrieval system