KEGG   Mus musculus (mouse): 20788Help
Entry
20788             CDS       T01002                                 

Gene name
Srebf2, AI608257, SREBP-2, SREBP2, SREBP2gc, bHLHd2, lop13, nuc
Definition
(RefSeq) sterol regulatory element binding factor 2
  KO
K09107  sterol regulatory element-binding transcription factor 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20788 (Srebf2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    20788 (Srebf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 20788
NCBI-ProteinID: NP_150087
MGI: 107585
Ensembl: ENSMUSG00000022463
UniProt: Q3U1N2
Position
15; 15 E1
AA seq 1130 aa AA seqDB search
MDESSELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGSN
GGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKVSPTPPRATPVL
QPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTS
PQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTD
SLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGTILTTMPVMMGQEKV
PIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLR
KAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSDVDLKIDDFNQNVLLM
SPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLG
LSFNPLTSLLQWGGAHNTDQHPYSGSGRSVLSLESGAGGWFDWMVPTLLLWLVNGVIVLS
VFVKLLVHGEPVIRPHSRPSVTFWRHRKQADLDLAKGDFAAAAANLQTCLSVLGRALPTS
RLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQRWRATPATAAGFEDEAKSSARDAALAYH
RLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKILPSTLIEIHLTAAMGLKTRCGGK
LGFLASYFLNRAQSLCGPEHSTVPDSLRWLCHPLGQKFFMERSWSIKSAAKESLYCAQRS
PADPIAQVHQAFCKNLLERAVESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSV
GFVTSPFSSSSVLRSALGPDVICRWWTSAVTMAISWLQGDDAAVRSRFTEVERVPKALEV
TESPLVKAVFYTCRAMHASLSGKADGQQNSFCHCERASGHLWSSLNVSGTTSDPSLNHVI
QLFTCDLLLSLRTALWQKQASASQLLGETYHASGTELAGFQRDLGSLRRLAHSFRPAYRK
VFLHEATVRLMAGASPTRTHQLLEHSLRRRPTQNTKHGEVDTWPGQRERATAILLACRHL
PLSFLSSPGQRAVLLAEAARTLEKVGDRRSCSDCQQMIVKLGGGTAIAAS
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atggatgagagcagcgagctgggcgttctggagaccatggagaccctcacggagctgggc
gatgagctgactctcggggacatcgacgagatgctacagtttgtcagcaatcaagtggga
gagttccctgatttgttttcagagcaactttgtagctccttccctggaggtggcagcaat
ggtggcagtggcaacaacagcagtggcagaggcaacaatggtggagccacagaccctgca
gtacagcggtcattcagccaggtcccattatctaccttctctccctcagctgcctcccct
caggctccggccctgcaggtcaaagtctctcctaccccaccaagggcaacccctgttctc
cagccgcgaccccagccccagccccaacctccagctcagctgcagcagcagacggtgatg
atcaccccgacgttcagcaccgctccgcagacgaggatcatccagcagcctttgatatac
cagaacgcagcgaccagctttcaagtcctgcagcctcaagtgcaaagcctcgtgacgtcc
ccgcaggtgcagcccgtcaccatccagcagcaggtgcagacggtacaggcccagcgggtg
ttgacgcagacagccaatggcacactgcagacccttgcccccgccacggtacagacggtc
gctgcgccacaggtgcagcaggtcccggtcctggtgcaacctcagatcattaagacagat
tcccttgtgttgaccacgctgaagacagatggcagccctgtcatggctgcagtccagaac
ccggccctcacggccctcactgcccccatccagacagccgcccttcaagtgccaaccctg
gtgggcagcaacgggaccattctgaccacaatgcctgtgatgatggggcaagagaaagtt
cctatcaagcaagtgcctggcggcgtgaagcagctggatcctcccaaagaaggagagagg
cggacaacacacaatatcattgaaaagcgctaccggtcctccatcaacgacaaaatcata
gagttgaaggacttagtcatggggacagatgccaagatgcacaagtctggcgttctgagg
aaggccattgattacatcaaatatctgcagcaggtcaatcacaagctgcgccaggagaac
atggtgctgaagctggccaatcagaaaaacaagctcctgaagggcatcgacctgggcagt
ctggtggacagtgatgtggacttgaaaattgatgactttaaccagaatgtccttctgatg
tctccgccggcctccgactccgggtcccaggccggcttctctccctattccattgactct
gagccgggcagccctctgctggatgacgcaaaggtcaaggatgaaccggactctcctcct
gtggcactgggcatggtggaccgctctcgaatcctcttatgtgtcctcaccttcctgggc
ctctcctttaaccccttgacttccttgctgcagtggggaggggcccacaacactgaccag
cacccatactcaggctcgggccgcagtgtactgtcactggagtcaggtgctgggggctgg
tttgactggatggttccaactctcctcctgtggctggtaaatggtgtgattgtcttgagc
gtctttgtgaagctgttggtccacggggagccggtgattcgcccacactcacgcccctca
gtcaccttctggagacaccggaagcaggcagacctagacctcgccaaaggtgatttcgca
gctgctgctgccaacctacaaacctgcttatccgtgctgggccgggcgctgcccacctcc
cgcctggacttggcctgcagcctctcctggaatgtgatccgctacagcctgcagaagctg
cgcctggtacgctggttactcaagaaggtcttccagcgctggcgggctactcccgccact
gcagctggctttgaggatgaggctaagagcagcgcaagggatgcggcactggcctaccac
aggctgcaccagctgcacatcacagggaagcttccggcgggatctgcctgttcagatgtg
cacatggctctgtgtgctgtgaacctggccgagtgtgcggaggagaaaatcctaccaagc
acactgattgagatccacctgacagcggccatggggctcaagacccgctgtggaggcaag
ctgggcttcttggctagctacttcttaaatcgtgcccagagtctgtgtggcccagagcat
agcactgtccccgactccctgcgctggctatgccatcccttgggccagaagtttttcatg
gagcgaagctggtcgatcaagtcagcagccaaggagagcctgtactgcgcccagaggagc
ccagctgaccccattgcccaggtacaccaggcgttctgcaaaaacctgctagaaagagcg
gtggagtccttggtgaaacctcaggccaagaagaaggcaggcgaccaggaagaagagagc
tgtgaattttccagtgctctagagtatttgaaattacttcattcttttgtggactctgtg
ggatttgtgacctcaccattctccagcagttccgtgctcaggtcggcccttggccccgat
gtcatctgccggtggtggacgtccgcagtcaccatggccatcagctggctccagggagac
gatgcagctgtgcgctctcgttttactgaagtagagcgggtccccaaggccctggaagtg
accgagagtcccttggtgaaggccgtcttctatacctgtagagccatgcatgcctccctc
tctgggaaagctgacgggcagcagaactccttctgtcactgtgagagggccagtggtcac
ctgtggagcagtctcaacgtcagcggcactacttctgatccttcacttaaccatgtgatc
cagctgttcacctgtgacctgctactgtcgctgaggacagcactctggcaaaagcaggcc
agtgccagccagctcctgggtgagacctaccatgcatccggcactgagctggccggcttc
cagcgggacctgggcagccttcgaaggctggcccatagcttccgcccagcctaccgcaag
gtgttcctgcatgaagccactgtgcgcctgatggcaggagccagccctacccgtacacac
cagctgctggagcatagcctacggcggcgccccactcagaacaccaagcatggagaggta
gacacctggcctggccaacgagagcgagctactgccatcctgctggcctgccgccatctt
cccctctctttcctgtcttccccgggccagcgggcagtgctgctggctgaagctgcccgc
accctggagaaggtgggtgaccgccgttcctgcagtgactgccagcagatgattgtcaag
ctgggcggtggcactgccatcgctgcctcctga

DBGET integrated database retrieval system