KEGG   Mus musculus (mouse): 207911Help
Entry
207911            CDS       T01002                                 

Gene name
Mchr1, AW049955, Gpr24, Mch1r
Definition
(RefSeq) melanin-concentrating hormone receptor 1
  KO
K04320  melanin-concentrating hormone receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    207911 (Mchr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    207911 (Mchr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Melanin-concentrating hormone (MCH)
    207911 (Mchr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 207911
NCBI-ProteinID: NP_660114
MGI: 2180756
Ensembl: ENSMUSG00000050164
UniProt: Q8JZL2
Position
15; 15 E1
AA seq 353 aa AA seqDB search
MDLQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcaagcctcgttgctgtccactggccccaatgccagcaacatctccgatggc
caggataatttcacattggcggggccacctcctcgcacaaggagtgtctcctacatcaac
atcatcatgccttcagtgtttggtaccatctgtctcctgggcattgtgggaaactccaca
gtcatttttgccgtggtgaagaaatccaagctgcactggtgcagcaacgtccctgacatc
ttcatcatcaacctctctgtggtggatctgcttttcctgctgggcatgcctttcatgatc
caccagctcatgggtaatggtgtctggcactttggggaaaccatgtgcaccctcatcaca
gccatggacgccaacagtcagttcaccagcacctacatcctgactgctatggccattgac
cgctacttggccaccgtccatcccatctcctccaccaagttccggaagccctccatggcc
accctggtgatctgcctcctgtgggctctctcgttcattagcatcactcctgtgtggctc
tatgccaggcttatccccttcccagggggtgctgtgggctgtggcatccgcctaccaaac
ccagatactgatctttactggttcactctgtatcagtttttcctggccttcgcccttccg
tttgtggtcatcactgctgcgtacgtgaaaatactacagcgcatgacgtcttcggtggcc
ccagcctctcaacgcagcatccggcttcggacaaagagggtgacccgcacagccattgcc
atctgtctggtcttctttgtgtgctgggcgccctactacgtgctgcagctgacccagttg
tccatcagccgcccgaccctcacattcgtctacctgtacaatgcggctatcagcttgggc
tatgccaacagctgcctcaatccctttgtgtacatagtactctgtgagacctttcgaaaa
cgcttggtgctgtcggtgaagcccgcggcccaggggcagcttcgcacggtcagcaatgct
cagacagctgacgaggagaggacagaaagcaaaggcacctga

DBGET integrated database retrieval system