KEGG   Mus musculus (mouse): 208098
Entry
208098            CDS       T01002                                 

Gene name
Panx3, 3230401P04, 4833413G11Rik
Definition
(RefSeq) pannexin 3
  KO
K20857  pannexin 2/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    208098 (Panx3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   208098 (Panx3)
SSDB
Motif
Pfam: Innexin
Other DBs
NCBI-GeneID: 208098
NCBI-ProteinID: NP_766042
MGI: 1918881
Ensembl: ENSMUSG00000011118
Vega: OTTMUSG00000027406
UniProt: Q8CEG0 Q6IMP0
Position
9; 9 A4
AA seq 392 aa
MSLAHTAAEYMLSDALLPDRRGSRLKGLRLELPLDKMVKFITVGFPLLLMSLAFAQEFSS
GSPISCFSPSNFSVRQAAYVDSSCWDSLAHHTQDKAGQYKVKSLWPHKALPYSLLALAVA
MYLPVLLWQYVAVPSLSSDLLFIISELDKSYNRSIRLVQHMLQIRQSSSDPHVFWDELEK
ARKERYFEFPLLERYLECKQRSHWLVATYLLRNALLLLFTSATYLYLGQFHLDVFFQDEF
NCFIKTGLLHDETHVPELITCRLTSLSVFQIVSVSSAAIYTILVPVIIYNLTRLCRWDKG
LLSIYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLSVLKDTTTQKH
NIDTVVDFMTFVAGLEPSKPKHLTQHTYDEHA
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcgctcgcacacactgctgcagagtacatgctctctgatgccctgctgcctgaccgc
aggggctctcggctcaaaggactgcgcctggaactgcccctggataagatggtcaagttc
attactgtgggctttcccttgctgctgatgtctctagctttcgcccaggagttctcatca
gggtctccgatcagctgtttctctcccagcaacttcagtgtcaggcaggctgcatacgtg
gatagctcatgctgggactcgctggctcaccatacgcaggacaaggctggccagtacaag
gtgaaatctctctggcctcacaaggctcttccctactctctactggctctggctgtggcc
atgtatctgccagtgttgctgtggcaatatgtagctgtgccctccctcagctctgacctg
ctgttcatcatcagtgagctggacaagtcttacaaccgttccatccgcctggtgcagcac
atgttgcagatccggcagagcagctctgacccccatgtcttctgggatgagctagagaag
gcccggaaggaacggtactttgaatttcccttgctagagcggtacctggaatgcaagcag
cgctcccattggctagtggccacctacctcctgaggaacgccctcttactcctctttacc
tcagccacttacctgtaccttggccaattccatttagatgtcttctttcaagacgaattt
aactgcttcatcaagacagggctgctacatgatgagacccatgtgccagagctgatcaca
tgcaggctgacctccctgtctgtattccagattgtgagtgtctccagtgcagcaatatac
accatattggtcccagtgataatatacaacctcacacggctatgtcggtgggacaaagga
ctcctatccatctatgagatgctcccagcttttgatctcctcagtagaaagatgctagga
tgccccatcaatgacctcaatgtgattcttcttttcctccgagctaatatctctgagctc
atctcttttagctggctgagtgtcttaagtgtgttgaaggatacaaccacccagaaacac
aacatcgacacagtggttgactttatgacctttgtggctggcttagaaccctcaaaacct
aaacatctcacccaacatacatatgatgaacacgcatag

DBGET integrated database retrieval system