KEGG   Mus musculus (mouse): 208117
Entry
208117            CDS       T01002                                 

Gene name
Aph1b, 2310057K14Rik, Aph1c
Definition
(RefSeq) aph1 homolog B, gamma secretase subunit
  KO
K06172  gamma-secretase subunit APH-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    208117 (Aph1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    208117 (Aph1b)
SSDB
Motif
Pfam: Aph-1
Other DBs
NCBI-GeneID: 208117
NCBI-ProteinID: NP_808251
MGI: 3522097
Ensembl: ENSMUSG00000032375
Vega: OTTMUSG00000036114
UniProt: Q8C7N7
Position
9; 9 C
AA seq 257 aa
MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVIT
DNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSINPEETAPSMRLLAYVS
GLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDG
CEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKL
CLLCQDKDFLLYNQRSR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgacggctgcggtgttctttggttgcgccttcatcgccttcgggcccgcgctcgctctt
tatgtcttcaccatcgccaccgaccctttgcgagtcatcttcctcatcgccggtgctttc
ttctggttggtgtctctcctgctgtcatccgttttttggttcctagtgagagtcattact
gacaacagagatggaccagtacagaattacctgctcatcttcggagtgttgctctctgtc
tgtatccaagagctgttcaggctcgcatattataagctgttaaaaaaagccagtgagggt
ttgaaaagcataaaccctgaggagacagcaccctcgatgcgactgttggcctatgtttct
ggcttgggctttggaatcatgagtggagtgttttcctttgtgaacaccctgtctaactcc
ttggggccaggcacagtgggcattcatggtgattctcctcagttcttccttaattcagct
ttcatgacactggtcgtcataatgctgcacgtgttctggggcgttgtgttctttgatggc
tgtgagaagaataagtggtacaccctcctcacggttctcctgacgcatctggtggtgtcc
acccagacttttctaagtccttattatgaagtgaatctggtaacagcatatataatcatg
gtgctcatgggcatctgggcattttatgttgccggaggcagctgccgaagcttgaaactc
tgcctgctctgccaagacaaggattttcttctttacaaccaacgctccagataa

KEGG   Mus musculus (mouse): 226548
Entry
226548            CDS       T01002                                 

Gene name
Aph1a, 6530402N02Rik, APH-1a
Definition
(RefSeq) aph1 homolog A, gamma secretase subunit
  KO
K06172  gamma-secretase subunit APH-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    226548 (Aph1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    226548 (Aph1a)
SSDB
Motif
Pfam: Aph-1 Peptidase_M3_N
Other DBs
NCBI-GeneID: 226548
NCBI-ProteinID: NP_666246
MGI: 2385110
Ensembl: ENSMUSG00000015750
Vega: OTTMUSG00000053041
UniProt: Q8BVF7 Q6GTF1
Position
3; 3 F2.1
AA seq 265 aa
MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCRRQEDSRVMVYSALRIPPED
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggggctgctgtgtttttcggatgcaccttcgtcgcgttcggcccagccttctccctt
ttcctgatcactgtagctggagacccacttcgggttatcatcctggtggcgggagccttt
ttctggctggtctccctgctcttggcttctgtggtctggttcatcttggtccatgtgaca
gaccgatcagatgcacggctccagtatggcctcctgatttttggtgctgctgtctctgtc
cttctacaggaagtgttccgttttgcttactacaagctccttaagaaggcagatgagggc
ttagcatcactgagtgaggacggaagatcacccatctccatccgacagatggcctatgtt
tctggtctgtccttcggtatcatcagtggtgtcttctctgttatcaatattttggctgat
gcacttgggccaggtgtggttgggatccatggagactcaccctattacttcctgacttca
gcctttctgacagcagccattatcctgctccacaccttttggggagttgtgttctttgat
gcctgtgagaggagacggtactgggctttgggcctggtagttgggagtcaccttctgaca
tcgggactgacattcctgaacccctggtatgaggctagcctgctgcccatctatgcagtc
accgtttccatggggctctgggcgttcatcacagccggaggctccctccgaagtatccag
cgcagcctttcgtgccgccggcaggaggacagtcgggtgatggtgtactctgccctgcgc
atcccacccgaggactga

KEGG   Mus musculus (mouse): 68318
Entry
68318             CDS       T01002                                 

Gene name
Aph1c, 0610008A10Rik, APH-1b, Aph1b
Definition
(RefSeq) aph1 homolog C, gamma secretase subunit
  KO
K06172  gamma-secretase subunit APH-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    68318 (Aph1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68318 (Aph1c)
SSDB
Motif
Pfam: Aph-1
Other DBs
NCBI-GeneID: 68318
NCBI-ProteinID: NP_080950
MGI: 1915568
Ensembl: ENSMUSG00000053040
Vega: OTTMUSG00000036116
UniProt: Q9DCZ9
Position
9; 9 C
AA seq 258 aa
MTLPVFFGCAFIAFGPAFALYLFTIATDPLRVIFLIAGAFFWLVSLLLSSMFWFLVRVIT
NNRDESVQNYLLIFGALLSVCIQELFRLAYYKLLKKASEGLKSINPEEDIAPSMRLLAYV
SGLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFD
GCEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLK
FCLLCQDKDFLLYNQRSR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgacgctgcctgtgttcttcggttgcgccttcatcgccttcgggcccgcgttcgcactc
tacctcttcaccatcgccaccgaccctttgcgcgtcattttcctcatcgctggtgctttc
ttctggttggtgtctctcctgctttcgtccatgttttggttcctagtgagagtcattact
aacaacagagatgaatcagtacagaattatctgctcatcttcggagcgttgctctctgtc
tgtatccaagagctgttcaggctcgcatattataagctgttaaaaaaagccagtgagggt
ttgaaaagcataaacccggaggaggacatagcaccctcgatgcgactgttggcgtatgtt
tctggcttgggctttggaatcatgagtggagtgttttcctttgtgaacaccctgtctaac
tccttggggccaggcacagtgggcattcatggtgattctcctcagttcttccttaattca
gctttcatgacactggtcgtcataatgctgcacgtgttctggggcgttgtgttctttgat
ggctgtgagaagaataagtggtacaccctcctcacggttctcctgacgcatctggtggtg
tccacccagacttttctaagtccttattatgaagtgaatctggtaacagcatatataatc
atggtgctcatgggcatctgggcattttatgttgctggaggcagctgccgaagcctgaaa
ttctgcctgctctgccaagacaaggattttcttctttacaaccaacgctccagataa

DBGET integrated database retrieval system