KEGG   Mus musculus (mouse): 20813Help
Entry
20813             CDS       T01002                                 

Gene name
Srp14, 14kDa, AW536328
Definition
(RefSeq) signal recognition particle 14
  KO
K03104  signal recognition particle subunit SRP14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    20813 (Srp14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    20813 (Srp14)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   20813 (Srp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRP14 DUF3509
Motif
Other DBs
NCBI-GeneID: 20813
NCBI-ProteinID: NP_033299
MGI: 107169
Ensembl: ENSMUSG00000009549
Vega: OTTMUSG00000015233
UniProt: P16254
Structure
PDB: 

Position
2; 2 E5
AA seq 110 aa AA seqDB search
MVLLESEQFLTELTRLFQKCRSSGSVFITLKKYDGRTKPIPRKSSVEGLEPAENKCLLRA
TDGKRKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKSKKSKPAQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctcgagagcgagcagttcctgacggagctgaccaggctcttccagaagtgc
cgctcgtcgggcagcgtgttcatcaccctcaagaaatatgacggtcgcaccaaacctatc
ccgaggaagagttctgtggagggcctcgagcccgcagaaaacaagtgtctgttgagagcc
acggatgggaaaaggaagatcagcaccgtggtgagctccaaagaagtgaacaagtttcag
atggcctattcaaatctactgagagccaacatggacgggctgaagaagagggacaagaag
aacaagagtaagaagagcaaaccagcacagtga

DBGET integrated database retrieval system