KEGG   Mus musculus (mouse): 208146
Entry
208146            CDS       T01002                                 

Gene name
Yeats2, BC042768, mKIAA1197
Definition
(RefSeq) YEATS domain containing 2
  KO
K24539  YEATS domain-contaning protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    208146 (Yeats2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    ATAC complex
     208146 (Yeats2)
Motif
Pfam: YEATS
Other DBs
NCBI-GeneID: 208146
NCBI-ProteinID: NP_001139402
MGI: 2447762
Ensembl: ENSMUSG00000041215
UniProt: Q3TUF7 B9EKJ4
Position
16; 16 A3
AA seq 1407 aa
MSGIKRTIKETDPDYEDVSVALPNKRHKAIESSARDAAVQKIETIIKEQFALEMKNKEHE
IDVIDQRLIEARRMMDKLRACIVANYYASAGLLKVSEGLKTFDPMAFNHPAIKKFLESPS
RSSSPTNQRSETPSANHSESDSLSQHNDFLSDKDNNSNVDVEERPPSTGEQRPSRKAGRD
TSSISGSHKRELRNADLTGDETSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVR
GSRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNK
RIDIIHNLKLDRTYTGLQTLGAETVVDVELHRHSLGEDSVYPQSSESDVCDAPPPTLTLP
AAVKASAVAQSPEPAAAAPVGEGFPETTEAERHSTFYSLPSSLERTPTKVTTAQKVTFSS
HGNSAFQPIASSCKIVPQSQVPNPESPGKSFQPITMSCKIVSGSPISTPSPSPLPRTPTS
TPVHLKQGTASSGVSNPHVIVDKPGQVIGASTPSTGSPTSKLPVASQASQGTGSPIPKIH
GSSFLTSTVKQEESLFASMPPLCPIGSHPKVQSPKAVTGGLGAFTKVIIKQEPGEAPHVS
TTGAASQSAFPQYVTVKGGHMIAVSPQKQVISAGEGTTQSPKIAPSKVVGVPVGSALPST
VKQAVAISSGQILVAKASSSVTKAVGPKQVVTQGVAKAIVSGGGGTIVAQPVQTLTKTQV
TAAGPQKSGSQGSVMATLQLPATNLANLANLPPGTKLYLTTNSKNPSGKGKLLLIPQGAI
LRATNNANLQSGSAAAGGSGSSGAGGGSGGGGGSGAGGTPSTSGPGGGPQHLTYTSYILK
QTPQGTFLVGQPSPQTPGKQLTTASVVQGTLGVSSSSAQGQQTLKVISGQKTTLFTQAAT
AGQASLLKLPDNTLKSVPAAPQLAKPGTTMLRVAGGVITAAPSPAVAFSANGAVHQSEGS
TPVSSSVGSIIKTPGQPQVCVSQATMATCKGPAAVAGTAASLVSAPSSISGKATVSGLLK
VHSAQSSPQQAVLTIPSQLKPLSINTSGGVQTVLMPVNKVVQSFSTSKLPTTVLPISVPN
QAAPSSAPVAIAKVKTEPETPGPNCISQENQVAVKTEESSELSNYVIKVDHLETIQQLLT
AVVKKIPLITAKGDDASCFSAKSLEQYYGWNIGKRRAAEWQRAMTVRKVLQEILEKNPRF
HHLTPLKTKHIAHWCRCHGYTPPDPESLRHDGDSIEDVLTQIDSEPECLSSFSTADDLCR
KLEDLQQFQKREPENEEEVDILSLSEPLKTNIKKEQEEKQEEMRFYLPPTPGSGFVGDIT
QKIGITLQPVALHRNMYASVVEDMILKATEQLVSDILRQALAVGYQTASPNRIPKEITVS
NIHQAICNIPFLDFLTNKHMGRLNEDQ
NT seq 4224 nt   +upstreamnt  +downstreamnt
atgtctggaatcaagcgaacaatcaaagaaactgaccctgattatgaggatgtatctgtg
gcccttccaaataagcggcataaagcgattgagagttcagctcgagatgcagctgtgcag
aaaattgagactattattaaggagcagtttgctcttgagatgaagaataaggaacatgag
attgatgtcattgaccagcgactgattgaagccaggaggatgatggataagctccgggcc
tgcattgtagcaaactattatgcctccgctggtctcctgaaggtttctgagggattaaag
acatttgatccgatggcttttaatcaccctgctatcaagaaatttttggaatcaccttct
aggtcatcatctcctaccaatcagagatcagaaacaccatctgccaatcactctgaaagt
gactctttatctcagcacaatgacttcctgtctgacaaagacaataacagcaacgtggat
gtggaggaaagacccccaagcaccggggaacagcgaccgagccgaaaggcaggaagggac
acgtctagtatcagtggctcccacaaacgggaactacggaatgctgacctcacaggagat
gagacttcacgactgtttgtcaagaaaacgatagtagtcggcaacgtgtccaagtacata
cctccagataagcgggaagaaaatgaccagtcaacccataagtggatggtatatgtccga
gggtcgcgtagagagcccagcattaatcactttgtcaagaaagtttggtttttccttcat
cctagctataaaccaaacgatcttgtggaagttagagagcccccctttcatctgactaga
agaggctggggtgagtttcctgtcagagtgcaagttcactttaaggacagccagaacaag
cggatagatatcatacacaacctgaagctggatagaacctacactggcctacagaccctg
ggtgcagagacggtggtggacgtcgagcttcatcggcactcgcttggtgaagactccgtt
tatcctcagtcgtcggaatcagacgtatgtgatgccccgcctccaaccctgacgcttcca
gccgccgtgaaagcctcagcagtggcacagtcccctgagccggcagctgctgcccctgtg
ggggaaggattcccagagaccactgaagctgagagacacagtacattttattctttacca
tcttcgttggaaagaacacccactaaagtgacaacagcacagaaggtcaccttcagttca
catgggaattctgccttccagcctatcgcatcaagctgcaaaattgtgccacaaagtcag
gtgcctaatcccgagtcacctggcaagtcctttcagccaatcaccatgagctgtaagatt
gtctcaggttctccaatatcaactccaagcccatcaccattacctcgcacaccaacttcc
actccagttcatttgaagcaaggcactgccagttctggtgtcagcaaccctcatgttatt
gtggataagcctgggcaggtcattggagcctccactccaagtacaggaagtcctacaagc
aagctcccagtggcctctcaggcttcccaaggaacagggtcccctattcctaagattcat
ggaagtagttttttgacatctactgtgaagcaggaggagtctttattcgcatctatgcca
cctctttgcccaattggtagtcaccctaaagtgcagagccccaaagctgtgactggagga
cttggggctttcacaaaggtgatcatcaaacaggaacctggagaagctcctcatgtgtcc
acaacaggagctgcgagccagtcagcattccctcagtatgtgaccgtgaaagggggtcac
atgatagctgtgtcccctcaaaagcaggtcataagtgctggagaagggaccactcagtca
ccaaagattgcaccctccaaggttgttggtgtgcctgttggctctgccttaccttccaca
gtgaagcaggctgtagcaatcagtagtggccaaatccttgtcgccaaggccagctcttct
gtcaccaaagctgttggtccaaaacaagttgtgacccaaggagttgccaaagcaatcgtg
agtggaggtggagggaccattgtcgctcagccagtgcagaccttaaccaagactcaggtc
acagctgctgggccgcagaagagtggctcccagggctcagtaatggccaccttgcaacta
ccagccactaatttggccaacctggcgaacttgcctccgggcactaaactgtaccttacc
acgaacagcaagaacccctcaggaaaagggaagctgctgctgattcctcaaggagccatc
ctgcgagctaccaacaatgccaacctgcagtctggctcggctgctgctggtggcagtggc
agcagtggtgcagggggaggcagtggaggtggcggtggcagcggagcaggaggaacccca
agcacctctggcccaggagggggcccccagcacctgacttacacatcctacatcctcaag
caaaccccccagggtacatttttagttggccaaccatcaccccaaacacctggaaaacaa
ctgactactgcatcggtggttcaaggaacactgggagtcagttcatcatctgcacaggga
caacagacactgaaagtcatctctggacagaaaaccactttgtttacacaggcagccact
gctgggcaggcatcgctgctgaagttaccagacaacaccctgaagtcagtgccagcagct
ccacagctcgccaagcctgggaccacgatgcttcgagtggcagggggggtgatcacagct
gctccctcccctgcagtggccttctcagcaaatggtgctgtacaccagtctgaaggatca
acccctgtgtcatcctctgttggttctataatcaaaactcctggtcagccacaagtgtgt
gtaagccaggccaccatggcaacctgcaagggccccgctgctgttgccggcactgccgcg
tccctggtatctgcaccaagctccatctctgggaaagccacagtgtcagggttgctaaaa
gttcattccgctcagtccagtccccagcaggctgtcctgacaattcccagtcaactcaag
ccactaagcatcaatacctctggtggcgtgcagactgtcttgatgcctgtgaataaagtg
gttcagtcgttttctaccagcaaattacctactactgtcctgcccataagtgttccaaat
caagctgcccccagctctgctccagtagcaattgccaaagtgaagactgaaccagaaact
cctgggccaaactgcatctcacaggagaaccaggtagcagtgaaaacagaagagagctct
gagctaagcaactacgtcattaaggtagaccatttggagaccatccagcagctcctgaca
gcagtagtgaagaagatcccattaattactgcaaaaggtgatgatgccagctgtttttct
gcgaagtccttggagcagtattacggctggaacattgggaagaggagagctgctgagtgg
caaagagcaatgacagtacgaaaagtgttacaagaaatcctggagaagaatccaagattc
caccacttgactcccctcaagaccaagcacattgctcactggtgccgctgccacggttac
accccaccagaccccgagagcctgcgacatgatggagactccattgaggatgtgctgacc
cagattgacagtgaaccagagtgcctgtcatccttctccactgctgatgacctctgccgg
aagctggaggatctgcagcagttccagaaaagggagcctgagaacgaggaagaagtggat
atcctcagcctgtcagagccactgaagacaaacattaaaaaggagcaggaagaaaagcag
gaagaaatgagattctaccttccaccaaccccaggctctggatttgttggtgacattaca
cagaagattggaatcaccctgcagcctgtggcgctgcacaggaacatgtatgcctcagtg
gtagaggacatgatcttaaaggccacggaacagctggtgagtgacatcctgagacaggca
ctggcagttggataccagacagcatctcccaacaggattcccaaagaaattacagtgagt
aatattcatcaggccatttgcaacattccttttctggattttcttacaaacaaacacatg
gggagactgaatgaggatcagtga

DBGET integrated database retrieval system