KEGG   Mus musculus (mouse): 20815
Entry
20815             CDS       T01002                                 

Gene name
Srpk1, AU017960
Definition
(RefSeq) serine/arginine-rich protein specific kinase 1
  KO
K15409  serine/threonine-protein kinase SRPK1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    20815 (Srpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20815 (Srpk1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20815 (Srpk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20815 (Srpk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  SRPK family [OT]
   20815 (Srpk1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    20815 (Srpk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 20815
NCBI-ProteinID: NP_058075
MGI: 106908
Ensembl: ENSMUSG00000004865
Vega: OTTMUSG00000024247
UniProt: O70551 Q3URR1 Q3UB06
Position
17; 17 A3.3
AA seq 648 aa
MERKVLALQARKKRTKAKKDKAQRKPETQHRGSAPHSESDIPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVDRPLTENPPNKMTQEKLEESNSIGQDQTLTERGGEGGAPEINCNGVI
GVVNYPENSNNETLRHKEDLHNANDCDVHTLKQEPSFLNSSNGDSSPSQDTDSCTPTASE
TMVCQSSAEQSLTRQDITQLEESIRADTPSGDEQEPNGALDSKGKFSAGNFLINPLEPKN
AEKLQVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATG
DYLFEPHSGEDYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWG
LLEVLVEKYEWPQEEAAGFTDFLLPMLELMPEKRATAAECLRHPWLNS
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcggaaagtgctcgcgctccaggcccgaaagaaaaggaccaaggccaagaaggac
aaagcccaaaggaagcctgaaactcagcaccgaggctctgcaccccactccgagagcgac
atcccagagcaggaggaggagattctagggtctgacgatgacgagcaggaagaccccaat
gactactgtaaaggaggttatcatcttgtgaaaattggagatctatttaacgggagatac
catgtgattcgaaaattgggctggggacacttttccacagtgtggttatcatgggatatt
cagggaaagaagtttgtagcaatgaaagtagttaaaagtgctgagcattacacagaaaca
gcactagatgaaatccggctgctgaaatcggttcgcaactcagacccgaatgatccaaat
ggagaaatggttgttcaactactagatgactttaaaatatcaggcgttaatggaacacat
atctgcatggtgtttgaggttttggggcatcatctactcaagtggatcatcaagtccaac
tatcaggggcttccgctgccttgtgtcaaaaaaattattcagcaagtgctacagggcctg
gattacttacacaccaagtgccggatcatccacacggacatcaaaccagagaacatcttg
ttgtctgtgaatgagcagtacattcgaaggctggctgcagaggccacagagtggcagcgc
tcaggagctcccccaccatcggggtctgcagtcagcactgctccacagcctaagccagct
gacaaaatgtcaaagaataagaagaagaaattgaagaagaagcagaagcgccaggcagaa
ttactagagaagcgaatgcaggaaattgaggaaatggagaaagagtcgggccctgggcaa
aaaagacctaacaagcaagaagaatcagagagtcctgttgacagacccctgacagagaac
ccacctaataaaatgacccaagagaaacttgaagagtcaaattccattggccaggaccag
acactcacggagcgtggtggagagggtggtgcgccagagattaattgcaatggagtgatt
ggagtcgttaattaccctgagaacagtaataatgagacactgaggcataaagaggatctg
cataatgctaatgactgtgatgtccacactttgaagcaggaacctagtttcctaaactct
tcaaatggagacagcagtccatctcaagacacagactcttgcacacccacggcctctgag
accatggtgtgccaatcctctgcagagcagtcactcacccgacaggacatcacccagctg
gaggagagcattcgggcagatacaccttctggggatgagcaggagcccaatggagccctg
gacagcaaaggaaaattctctgctggaaattttcttattaatccccttgagccaaaaaat
gcagagaagctccaagtgaagatcgcagacctcgggaacgcctgctgggtgcacaagcat
ttcactgaagatatccagacacggcagtatcggtctttggaagtcctgataggatctggc
tacaacacccctgctgacatctggagcacagcatgcatggcctttgaactagccacaggg
gactatttgtttgagcctcattcaggggaggattacacacgagatgaagaccacatcgcc
ctgatcatagaacttctggggaaggtgcctcgcaagctcattgtggcaggaaaatactcc
aaggaatttttcaccaaaaaaggtgacctgaagcacatcaccaagttgaagccttggggt
cttctggaggttctggtggagaaatatgagtggcctcaggaggaggctgccggcttcaca
gatttcctgctgcccatgttggagcttatgcctgagaagagagccactgctgctgagtgt
ctccggcatccttggctaaactcctaa

DBGET integrated database retrieval system