KEGG   Mus musculus (house mouse): 208154
Entry
208154            CDS       T01002                                 
Symbol
Btla, A630002H24
Name
(RefSeq) B and T lymphocyte associated
  KO
K06707  B- and T-lymphocyte attenuator
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    208154 (Btla)
CD molecules [BR:mmu04090]
 Proteins
  208154 (Btla)
SSDB
Motif
Pfam: V-set Ig_2 Ig_3 ig I-set TMEM154 IalB
Other DBs
NCBI-GeneID: 208154
NCBI-ProteinID: NP_001032808
MGI: 2658978
Ensembl: ENSMUSG00000052013
UniProt: Q7TSA3 Q32MV8 E9QNY6
Structure
Position
16:45043121..45073258
AA seq 306 aa
MKTVPAMLGTPRLFREFFILHLGLWSILCEKATKRNDEECPVQLTITRNSKQSARTGELF
KIQCPVKYCVHRPNVTWCKHNGTICVPLEVSPQLYTSWEENQSVPVFVLHFKPIHLSDNG
SYSCSTNFNSQVINSHSVTIHVTERTQNSSEHPLITVSDIPDATNASGPSTMEERPGRTW
LLYTLLPLGALLLLLACVCLLCFLKRIQGKEKKPSDLAGRDTNLVDIPASSRTNHQALPS
GTGIYDNDPWSSMQDESELTISLQSERNNQGIVYASLNHCVIGRNPRQENNMQEAPTEYA
SICVRS
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaagacagtgcctgccatgcttgggactcctcggttatttagggaattcttcatcctc
catctgggcctctggagcatcctttgtgagaaagctactaagaggaatgatgaagagtgt
ccagtgcaacttactattacgaggaattccaaacagtctgccaggacaggagagttattt
aaaattcaatgtcctgtgaaatactgtgttcatagacctaatgtgacttggtgtaagcac
aatggaacaatctgtgtaccccttgaggttagccctcagctatacactagttgggaagaa
aatcaatcagttccggtttttgttctccactttaaaccaatacatctcagtgataatggg
tcgtatagctgttctacaaacttcaattctcaagttattaatagccattcagtaaccatc
catgtgacagaaaggactcaaaactcttcagaacacccactaataacagtatctgacatc
ccagatgccaccaatgcctcaggaccatccaccatggaagagaggccaggcaggacttgg
ctgctttacaccttgcttcctttgggggcattgcttctgctccttgcctgtgtctgcctg
ctctgctttctgaaaaggatccaagggaaagaaaagaagccttctgacttggcaggaagg
gacactaacctggttgatattccagccagttccaggacaaatcaccaagcactgccatca
ggaactggaatttatgataatgatccctggtctagcatgcaggatgaatctgaattgaca
attagcttgcaatcagagagaaacaaccagggcattgtttatgcttctttgaaccattgt
gttattggaaggaatccaagacaggaaaacaacatgcaggaggcacccacagaatatgca
tccatttgtgtgagaagttaa

DBGET integrated database retrieval system