KEGG   Mus musculus (mouse): 20817Help
Entry
20817             CDS       T01002                                 

Gene name
Srpk2, AW226533, AW492537, AW547358, Wbp6, mSRPK2
Definition
(RefSeq) serine/arginine-rich protein specific kinase 2
  KO
K08831  serine/threonine-protein kinase SRPK2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20817 (Srpk2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    20817 (Srpk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20817 (Srpk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  SRPK family [OT]
   20817 (Srpk2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    20817 (Srpk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal SWIRM-assoc_2 CNDH2_C
Motif
Other DBs
NCBI-GeneID: 20817
NCBI-ProteinID: NP_033300
MGI: 1201408
Ensembl: ENSMUSG00000062604
Vega: OTTMUSG00000053492
UniProt: O54781 A0A0R4J124 Q8CBI1
Position
5 A3; 5 10.36 cM
AA seq 682 aa AA seqDB search
MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPLPDPAPPEPEEEILGSDDEEQEDPAD
YCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETA
LDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNY
QGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKA
GAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERKIL
EENITSAEASGEQQDGEYQPEVTLKAADLEDTTEEETAKDNGEVEDQEEKEDAEKENAEK
DEDDVEQELANLDPTWVESPKANGHIENGPFSLEQQLEDEEDDEDDCANPEEYNLDEPNA
ESDYTYSSSYEQFNGELPNGQHKTSEFPTPLFSGPLEPVACGSVISEGSPLTEQEESSPS
HDRSRTVSASSTGDLPKTKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQ
TRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELL
GSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPM
LEMVPEKRASAGECLRHPWLNS
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaactctgagaagtcgtcctcttcagaaaggccggagcctcaacagaaagct
cctttagttcctcctcctccaccaccaccaccgccaccaccactgccagaccccgcaccc
ccagagccagaggaggagattctggggtcagatgatgaggagcaggaggaccccgcagat
tactgcaaaggtggctatcatccagtgaaaattggagatctcttcaatggtcgatatcat
gtcattagaaagctaggatgggggcacttttctactgtatggctgtgctgggatatgcaa
gggaaaagatttgttgcaatgaaagttgtaaaaagtgcccagcattatacagagacagcc
ttggatgaaattaaactactcaaatgcgttcgagaaagtgaccccagtgacccaaacaaa
gacatggtagttcagctaattgatgacttcaagatctcaggcatgaatgggatacatgtc
tgcatggtctttgaagtacttggtcaccatctcctcaaatggatcatcaaatccaactat
caaggcctcccagtacgttgtgtgaagagtatcattcgacaggtccttcaagggttagat
tatctacacagtaagtgcaagataattcacaccgacataaagccggaaaacatcttgatg
tgtgtggatgacgcttacgtgagaagaatggcagccgaagccacggagtggcagaaagca
ggtgctcctcctccctctgggtctgcagtgagtacggctccacagcaaaaacctatagga
aaaatatctaaaaacaaaaagaaaaagctgaaaaagaaacagaagagacaggctgagttg
ctggagaaacgcctacaggagattgaggaattggagcgagaagccgaaaggaaaatccta
gaggagaacatcacctctgcagaagcttccggggagcagcaggatggagagtaccagccg
gaggtgacactgaaagcagccgacttagaggacacaactgaggaagagacagcaaaggat
aatggtgaagttgaagaccaggaagagaaagaagatgcagagaaggagaacgcggagaag
gatgaagatgatgttgaacaggaacttgcaaacttagaccctacctgggtggagtccccg
aaagccaatggccatattgaaaatggcccgttctcactggagcagcagctggaggatgaa
gaggacgatgaagatgactgtgcaaatcccgaggagtataacctcgatgagccaaatgca
gagagtgattacacgtatagcagctcctatgaacaattcaatggtgaattgccaaatgga
caacataagacttcagagtttcccacaccgttgttttctgggcccttagaacctgtggcc
tgtggctctgtgatttcagagggatcgccacttaccgagcaggaggaaagcagtccctcc
catgacagaagcaggacagtttcagcctctagtactggagatttgccaaaaacaaaaacc
cgggcggctgacctgttggtgaaccctctggatccacggaatgcagataaaattagagta
aaaattgctgacctgggaaatgcttgttgggtgcataaacatttcacagaggatatccag
acacgtcagtataggtccatagaggttttaataggagcaggctacagcacacctgcagac
atttggagtacagcttgcatggcatttgagctcgccacaggagactatttgttcgaaccg
cattctggggaagactattccagagatgaagaccacatagcccacatcatagagctgcta
ggcagtatcccaaggcactttgctctgtctggaaaatattctcgggaattcttcaatcgc
agaggagaactgcggcacatcaccaagctgaagccctggagcctctttgatgtacttgtg
gaaaagtatggctggccccatgaagatgctgcacaatttacagatttcctgatcccaatg
ttagagatggttccagaaaaacgagcctcagctggcgaatgccttcgacatccttggttg
aattcttag

DBGET integrated database retrieval system