KEGG   Mus musculus (mouse): 20821Help
Entry
20821             CDS       T01002                                 

Gene name
Trim21, Ro52, Ssa1
Definition
(RefSeq) tripartite motif-containing 21
  KO
K10651  tripartite motif-containing protein 21 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    20821 (Trim21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    20821 (Trim21)
   04131 Membrane trafficking [BR:mmu04131]
    20821 (Trim21)
   04121 Ubiquitin system [BR:mmu04121]
    20821 (Trim21)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     20821 (Trim21)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     20821 (Trim21)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    20821 (Trim21)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    20821 (Trim21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY SPRY zf-B_box zf-C3HC4 zf-C3HC4_4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-C3HC4_2 zf-RING_6 zf-RING_5 zf-RING_10 TMCO5 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 20821
NCBI-ProteinID: NP_001076021
MGI: 106657
Ensembl: ENSMUSG00000030966
Vega: OTTMUSG00000060441
UniProt: Q3U7K7 Q3UCL2
Structure
PDB: 

Position
7; 7 E3
AA seq 462 aa AA seqDB search
MSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLR
PNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHT
RVPIEEAAKVYQEKIHVALEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFAL
QNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELL
QEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISK
DRRQVRMGDTHQNVSDNEERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQ
RKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITD
HGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtctctggaaaagatgtgggaggaggtcacctgttctatctgcctggatcccatggtg
gagcctatgagtatcgaatgtggccattgcttttgcaaggaatgcatttttgaagttggg
aagaatgggggcagttcatgtcccgagtgccggcaacagtttctgctccgaaacctcagg
cccaatagacatatagccaacatggtggaaaaccttaaacagatagcccagaataccaag
aagagtacccaggaaacgcactgcatgaagcatggagagaagcttcacctattctgtgag
gaagatgggcaggccctttgctgggtgtgtgcccagtctgggaaacaccgggaccacacc
agggtccctattgaagaggctgctaaggtataccaggagaagatccacgtggctttagaa
aaactgagaaaggggaaagagttggccgagaagatggaaatggatctcacgatgcaaaga
acagactggaagaggaacattgacacccagaagtcgaggattcacgcagagttcgcactt
cagaatagcttgctggctcaggaggagcagaggcagctgcagaggctggagaaggatcaa
agggagtacctgagactcctggggaagaaggaggctgagctggctgagaagaaccaggcc
ctgcaggagctgatctcagagctggagaggaggattcgtggttcagagctggagctactg
caggaggtgaggatcatcctggaaaggagtggatcctggaacctggacacgttagatatt
gacgccccagacctaacaagcacatgccctgtgccagggcggaagaagatgctgaggaca
tgttgggttcatattactctggatcgcaacaccgccaactcatggctcatcatctcaaag
gatcggagacaagtgaggatgggagacacccatcagaacgtgtctgacaatgaggagagg
tttagtaattaccccatggtgctaggtgcccagagattctcctctgggaagatgtactgg
gaggtagatgtgactcaaaaggaggcctgggatctgggggtttgcagagattctgttcag
aggaaagggcagttttcactcagtcccgagaatggcttctggaccatttggttatggcaa
gacagctatgaggctggtaccagtcctcagaccaccctccacattcaagtacctccatgc
caaattgggatctttgtggactatgaggctggcgttgtctccttctacaacataactgac
catggctccctcatttacaccttctcggagtgtgtttttgctggacctctgcgacctttc
ttcaatgttggtttcaattatagtgggggaaatgcagcgcctctaaagctctgtccacta
aagatgtga

DBGET integrated database retrieval system