KEGG   Mus musculus (mouse): 20822
Entry
20822             CDS       T01002                                 

Gene name
Ro60, 1810007I17Rik, A530054J02Rik, AI646302, SS-A/Ro, Ssa, Ssa2, Trove2
Definition
(RefSeq) Ro60, Y RNA binding protein
  KO
K11089  60 kDa SS-A/Ro ribonucleoprotein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    20822 (Ro60)
SSDB
Motif
Pfam: TROVE DUF2201 VWA_2 Cut12
Other DBs
NCBI-GeneID: 20822
NCBI-ProteinID: NP_038863
MGI: 106652
Ensembl: ENSMUSG00000018199
Vega: OTTMUSG00000021864
UniProt: O08848 Q3TJ75
Position
1 F; 1 62.54 cM
AA seq 538 aa
MEGSANQLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGCEVIQEIKSFSQEGRTAKQEPLLFALAVCSQCADINTKQAAFKAVPEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAVADWYNEKGGMAVALVVTKYKQRNGWSHK
DLLRLSHLKPSSEGLAIVTKYITKGWKEVHEEYKEKALSVEAEKLLKYLEAVEKVKRTKD
DLEVIHLIEEHQLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLICEKLSNEKLLKKARIHPFHVLIALETYRAGHGLRGKLKWIPDKDILQALDAAFYTT
FKTVEPTGKRFLLAVDVSASMNQRALGSVLNASTVAAAMCMVVTRTEKESSVVAFACDMV
PFPVTTDMTLQQVLTAMNKVPAGNTDCSLPMIWAQKTDTAADVFVVFTDNETFAGQVHPA
VALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTAALDVIRNFTLDVI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggaaggatctgcaaaccagttgcagccactgagtgagactcaagtagttaactcagag
ggcggctgtgtatggcaggtcaccgacatgaaccggctgcgccgcttcttgtgttttggc
tctgaaggtggcacgtactatatcaaagaacagaagctgggccttgagaatgctgaagcc
ttaattagactgattgaagacggcagaggatgtgaagtgatccaggaaatcaagtccttt
agtcaggaaggcaggactgccaaacaagagccactgctgtttgcactggccgtttgttcc
cagtgtgcggacataaacacaaagcaagcagcctttaaagctgtccctgaagtgtgtcgc
attccgacccacctcttcacttttatccagtttaagaaagacctgaaggagagcatgaag
tgtggcatgtggggtcgcgccctccggaaggcagtggcagactggtacaatgaaaaaggc
ggcatggccgtggcgctggtggttacaaagtataaacaacgaaacggctggtctcacaaa
gatctcctccgactgtcccaccttaagccttccagtgaaggacttgctattgtgaccaag
tatatcacaaagggctggaaagaagtccatgaagagtataaagaaaaggcgctttctgtg
gaggctgagaagctgctcaagtacctggaggctgtggagaaagtgaagcgcacgaaagac
gacctggaagtcattcatctgattgaagagcatcagttagttagggaacacctgctgaca
aatcacttgaagtctaaagaggtatggaaggctttgttacaggaaatgccccttactgcg
ctcctgaggaacctgggaaagatgactgctaattcagtgcttgaaccaggaaactctgaa
gtatctttaatatgtgaaaaactgagcaatgaaaagctgctcaaaaaggctcgtatacat
ccatttcatgttttaattgcattagagacctacagagcaggccacgggctcagagggaaa
ctgaagtggattccagataaagacatcttgcaagccttagatgctgctttttatacaaca
tttaagactgttgaaccaactgggaagcgcttcttgctcgctgttgacgtcagtgcctct
atgaaccagagagccttgggtagtgtactcaatgctagtactgttgccgcagcaatgtgc
atggtggttacacggacagaaaaagagtcttcggtggttgcttttgcctgtgatatggtt
ccgtttccagtgactacagacatgacattacagcaggttttaacggctatgaataaagtt
ccagcaggcaacacggattgctctctcccaatgatctgggcccagaaaacagacacagcc
gcagatgtcttcgttgtgtttactgataatgagacctttgcagggcaggtgcatcctgct
gttgccctgagagagtaccgaaagaaaatggatattcctgctaaattgattgtttgtggg
atgacatcaaatggctttaccattgcagacccagacgatagaggcatgttggatatgtgc
ggctttgatactgcagctctggatgtaattcggaatttcacattggatgtcatttaa

DBGET integrated database retrieval system