KEGG   Mus musculus (mouse): 20823Help
Entry
20823             CDS       T01002                                 

Gene name
Ssb, SS-B
Definition
(RefSeq) Sjogren syndrome antigen B
  KO
K11090  lupus La protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    20823 (Ssb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_3 La RRM_1
Motif
Other DBs
NCBI-GeneID: 20823
NCBI-ProteinID: NP_001103615
MGI: 98423
Ensembl: ENSMUSG00000068882
Vega: OTTMUSG00000013038
UniProt: P32067 Q564E6
Position
2 C2; 2 40.95 cM
AA seq 415 aa AA seqDB search
MAENGDNEKMTALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLETMIKFNRLNR
LTTDFNVIVQALSKSKAKLMEVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGFPT
DATLDDIKEWLDDKGQILNIQMRRTLHKTFKGSIFAVFDSIQSAKKFVEIPGQKYKDTNL
LILFKEDYFAKKNEERKQSKVEAKLKAKQEHEGRHKPGSTETRALEGKMGCLLKFSGDLD
DQTCREDLHFLFSNHGEIKWVDFARGAKEGIILFKEKAKEALEKARNANNGNLLLRNKKV
TWKVLEGHAEKEALKKITDDQQESLNKWKSKGGHAGGRFKGSHVFTAARRFKGKGKGNRP
GYAGAPKGRGQFHGRRTRFDDDDRRRGPMKRGRDGRDREEPASKHKKRENGARDK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatggagataatgaaaaaatgactgctttggaggccaaaatctgtcatcaa
attgagtattattttggagacttcaatttgccacgagacaagtttttaaaagaacagatc
aaattggatgaaggctgggtacctttggaaacaatgataaaattcaacaggctaaaccgg
ctgacaacagactttaatgtaattgtgcaagcactgagcaaatctaaggcaaaactcatg
gaagtcagtgcagacaaaactaaaattagaagatcaccaagcagaccactccctgaagtg
acggatgagtataagaatgatgtaaaaaacagatctgtttatattaaaggtttcccaact
gacgccacccttgatgatataaaagaatggctagacgataaaggccaaatactgaatatt
caaatgagaagaacattacacaaaacatttaaggggtcaatatttgctgtgtttgatagt
attcagtctgcaaagaagtttgtggagatccctggccagaagtacaaagacactaacctg
ctaatactctttaaggaagattactttgcaaaaaaaaatgaagaaagaaagcagagcaaa
gtggaagctaaattaaaagctaaacaagagcatgaaggaagacacaagccaggaagtact
gaaaccagagctctagaaggaaagatgggatgcttactgaagttttcaggtgacttggat
gaccagacctgtagagaagatttacacttccttttctcaaatcatggtgaaataaaatgg
gtcgactttgccagaggagcaaaagagggaataattctcttcaaagaaaaggctaaggaa
gcacttgagaaagccagaaatgcaaataatggtaacctactgttaaggaacaaaaaggtg
acttggaaagtactagaaggacatgcggaaaaagaagcattgaaaaaaatcacagatgat
cagcaagaatccctaaacaaatggaagtcaaaaggagggcatgcaggtggaagatttaaa
ggaagccatgtttttacagcagcccgcagatttaaaggaaaagggaagggtaataggcct
ggttatgctggggcacccaaaggaagaggacagtttcatggaaggaggacaagatttgat
gatgatgatcgtcgtcgtggaccaatgaaaagaggaagagatggaagagacagagaagaa
cccgcatcaaagcataagaaaagagaaaatggtgctagagacaagtag

DBGET integrated database retrieval system