KEGG   Mus musculus (mouse): 208266
Entry
208266            CDS       T01002                                 

Gene name
Dot1l, A630076O07, AW907654, Dot1, KMT4, mDot1
Definition
(RefSeq) DOT1-like, histone H3 methyltransferase (S. cerevisiae)
  KO
K11427  [histone H3]-lysine79 N-trimethyltransferase [EC:2.1.1.360]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    208266 (Dot1l)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    208266 (Dot1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    208266 (Dot1l)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.360  [histone H3]-lysine79 N-trimethyltransferase
     208266 (Dot1l)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     208266 (Dot1l)
   HMT complexes
    Dot1-containing complex
     208266 (Dot1l)
SSDB
Motif
Pfam: DOT1
Other DBs
NCBI-GeneID: 208266
NCBI-ProteinID: NP_955354
MGI: 2143886
Ensembl: ENSMUSG00000061589
Vega: OTTMUSG00000017289
UniProt: Q6XZL8
Position
10; 10 C1
AA seq 1540 aa
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNATTPTKVP
ESKAAATEAPADSGAEEEKSGVATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMSAAS
AERKSKKSQSTLDLLHSPPPAPPSASPQDAYRAPHSPFYQLPPSTQLHSPNPLLVAPTPP
ALQKLLESFRIQYLQFLAYTKTPQYKANLQQLLDQEKEKNTQLLGTAQQLFGHCQAQKEE
IRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEKDNSELRSQSLRLLRA
RCEELRLDWSTLSLENLRKEKQALRSQISEKQRHCLELQISIVELEKTQRQQELLQLKSC
VPPDDALSLHLRGKGALGRELEADAGRLRLELDCAKISLPHLSSMSPELSMNGHAASYEL
CNAASRPSSKQNTPQYLASPLDQEVVPCTPSHSGRPRLEKLSGLALPDYTRLSPAKIVLR
RHLSQDHTGASKAATSEPHPRPEHPKESSLPYQSPGLSNSMKLSPQDPPLASPATSPLTS
EKGSEKGVKERAYSSHGETITSLPVSIPLSTVQPNKLPVSIPLASVVLPSRAERARSTPS
PVPQPRDSSATLEKQTGASAHGAGGAGAGSRSLAVAPTGFYAGSVAISGALASSPAPLAS
GMESAVFDESSGPSSLFATMGSRSTPPQHPPLLSQSRNSGPASPAHQLTASPRLSVTTQG
SLPDTSKGELPSDPAFSDPESEAKRRIVFSISVGASSKQSPSTRHSPLTSGTRGDCVQSH
GQDSRKRSRRKRASAGTPSLSTGVSPKRRALPTVAGLFTQSSGSPLNLNSMVSNINQPLE
ITAISSPESSLKSSPTPYQDHDQPPVLRKERPLGLTNGAHYSPLTSDEEPGSEDEPSSAR
IERKIATISLESKSPPKTLENGGGLVGRKSAPSSEPINSSKWKSTFSPISDLGLAKAVDS
PLQAGSALSHSPLFSFRPSLEEPAAEAKLPTHPRKSFAGSLGAAEGPSPGTNPPNGLAFS
GGLAADLGLHSFNDGASLSHKGPDVTGLSASLSFPSQRGKDSTTEANPFLSRRQPEGLGG
LKGEGNANKESGESLPLCGPSDKASLPHGSRASKGRDRELDFKGGHNLFISAAAVPPGGL
LGGPGLVTVASSAGSATPTAQAPRPFLSTFAPGPQFTLGPMSLQANLGSVAGSSVLQSLF
STVPAAAGLVHVSSTATRLTNSHTMGSFSSGVAGGTVGGN
NT seq 4623 nt   +upstreamnt  +downstreamnt
atgggcgagaagctggagctgaggctcaagtcgcctgtgggcgccgagcccgccgtctac
ccgtggccgctgccggtctacgacaagcaccatgatgctgctcatgagattattgagact
atccggtgggtctgcgaggaaatcccagatctcaagctggccatggagaactatgtcctg
atcgactacgacaccaaaagttttgaaagcatgcagcggctgtgtgacaaatacaaccgg
gccatcgacagcatccaccagctgtggaagggcactacacagcccatgaagctgaatact
cggccgtccaatggacttctgcggcacatcctgcagcaggtatataaccactctgtcact
gacccggagaagcttaacaactacgagcccttctcccctgaggtgtatggggagacctcc
tttgacctggtggcccagatgattgatgagatcaagatgacagaggatgacctgtttgtc
gacctgggcagtggtgtggggcaggttgtccttcaggttgctgcggccaccaactgcaaa
catcactacggagtggagaaagcggacatcccagccaagtacgcagagaccatggaccga
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacactggaacga
ggtgacttcctctcagaggaatggagggaacggatcgccaacacgagtgttatatttgtg
aataactttgcctttggtcctgaggtggatcaccagctgaaggagcgattcgcaaacatg
aaggaaggcggcagaatcgtatcctcaaagccctttgcccctctgaacttcaggatcaac
agcaggaacttgagtgacattggcaccatcatgcgtgtggtggagctgtcgcccctgaag
ggctctgtgtcgtggactggcaagcctgtctcctactatctgcacaccattgaccgcacc
atacttgaaaactatttttctagtctgaaaaatccaaaactcagggaggagcaggaggca
gctaggcgaagacagcagcgagagaacaagagcaatgcgaccacgcccaccaaagtccct
gagagcaaagcagctgccactgaggcccccgcggattctggtgctgaggaagaaaaatca
ggtgtggctactgtcaaaaagccatctccctccaaagcccggaagaagaaactgaacaag
aaagggagaaagatggctggccggaaacgtgggcggcccaagaaaatgagtgctgccagt
gccgaacgcaagtctaagaagagccaaagcacactggatctcctgcactctccgccccca
gccccaccctcagcctcaccccaggatgcgtacagggcacctcacagcccattctaccag
ctacctccaagcacgcagctgcactcacccaacccactgctagtggcacccaccccacct
gcgctgcagaagcttttagagtccttcagaatccagtacctgcagttcctggcttataca
aagaccccgcagtacaaggctaacctacagcagcttctggaccaggagaaggagaagaac
acacagctcctgggcacagcccagcagctcttcggccattgccaggcccaaaaggaagaa
atccgcaggctgttccagcagaagctggatgagttgggcgtgaaggcgctgacctacaat
gacctgattcaggcccagaaggaaatctctgcccacaaccagcagctgcgggaacagtcg
gaacagctggagaaggacaacagcgagcttcggagccagagcctgcggctgctcagggcc
cggtgtgaggagctgaggcttgactggtccacactgtccttggagaacctgcggaaagag
aagcaggccctgaggagccagatctcagagaagcagcggcactgcctggagctgcagatc
agcatcgtggagctcgagaagacccagcgccagcaggagctcctgcagttaaagtcctgt
gtaccaccagatgatgctttgtctttgcatctgcgtggcaagggtgccctgggccgagag
ctggaggctgatgctgggcgcttacgccttgagctggactgtgccaagatctccctgcca
cacctcagcagcatgagccctgagctgtccatgaacggccatgctgccagctatgagctc
tgcaatgcagctagtcggccatcatccaagcagaacacaccccagtacctggcctctccc
ttggaccaggaggtcgtaccttgtacccctagccacagtggccggcctcggctagaaaag
ctgtctggcctggctttgcctgattacacccggttgtcacctgccaagattgtgttgagg
cggcacctgagccaggaccacactggggctagcaaagcagctaccagtgagccacaccct
cggccagagcaccccaaggagagcagccttccctaccagagccctggcttgtccaacagc
atgaagctcagcccccaggatccaccactggcctccccggcaacctcgcccctcacctcc
gagaaaggtagtgagaagggtgtgaaggagcgtgcctacagcagccacggggagaccatc
accagcctacctgttagcattccactcagcacagtgcagcccaacaagctgccggtcagc
atcccactggccagcgtggtgctgcccagccgtgctgagagggcgaggagcactcccagc
cctgtgccacagccccgggactcttcagccacacttgagaagcagactggtgcttctgcc
catggtgcagggggtgctggagcaggaagcaggagcctcgctgtggcgcccacaggtttc
tatgctggttcggtggccatcagtggggccctggccagcagcccagcacctctggcctct
ggaatggaatctgctgtttttgatgaatcctctggccccagcagcctctttgccaccatg
gggtctcgcagcacaccaccacaacacccacctctcctgtcgcagtcccgcaactcgggt
cctgcctctcctgcccaccaactcacagccagtccccgcctgagtgtgaccactcagggc
tcgctgccagacaccagcaaaggggaactgccttctgatcctgccttctcagacccagag
agcgaagcaaaaaggaggattgtgttcagcatttcagttggtgccagctccaagcagtca
ccttccaccaggcatagccccttgacttctggcacccgaggggactgtgtgcagagccac
ggacaggacagtcgtaagcgcagcagaaggaagcgtgcatcagctggaacacctagcctc
agcacgggtgtgtcccccaagcgccgggctctgccaactgttgctggcctctttacacag
tcctcggggtctcctcttaatctcaactccatggtcagcaacatcaaccagccactggag
atcacagccatctcatcccctgagagctccctgaagagctcccccaccccataccaggac
catgaccagcctccggtgctcaggaaggaacggcctctaggactaactaatggggcccac
tactcgccactgacctcagatgaggagccaggctctgaggatgagcccagcagtgcccga
attgagagaaaaattgcaacaatctctttagaaagcaaatctcccccgaagacactggaa
aatggtggtggcttggtgggaaggaagtcagccccttcgagcgagcctatcaacagcagc
aaatggaagtctaccttctctcctatctctgacctcggcttggccaaggctgtggacagt
ccgctacaggctggctctgccctgagccacagccccctgttctctttccggccgtccctg
gaggagcctgctgctgaggccaagctccccactcacccaaggaaaagctttgcgggctct
ctgggtgcagccgaggggccaagccctggcaccaaccctcccaacggcctggccttcagt
gggggccttgctgcagacctcggtttacacagcttcaatgatggtgcttccctctcccac
aagggcccggatgtgactggcctgagtgcctccctgagcttcccatcccagaggggcaag
gacagtaccacagaggccaaccctttcctcagcaggcggcagcccgagggcctgggtggc
ttgaagggtgagggcaacgcaaacaaggagtcaggagagagcctgcccctgtgcgggccc
tcggacaaggcctcactgccacatggcagcagggccagcaaaggtcgtgaccgtgagctg
gacttcaagggcggccacaacctcttcatctctgctgcagccgtgcctccaggtggcctc
cttggtggccctggtcttgtaactgtggcttcttctgcgggcagtgcaacacccactgcc
caggctccccggcctttcctgagcacctttgcccccgggccccagtttactctgggcccc
atgtccctgcaggccaacctgggctctgtggccggctcctctgtgctgcagtccttgttc
agcactgtgccagctgctgcaggcctggtgcatgtgtcgtccactgcgacccgattgacc
aactcacacaccatgggcagcttctcttctggggtggccggcggaaccgttggaggtaat
tag

DBGET integrated database retrieval system