KEGG   Mus musculus (house mouse): 20834
Entry
20834             CDS       T01002                                 
Symbol
Znrf4, 1700094M01Rik, Ssrzf1, spzn
Name
(RefSeq) zinc and ring finger 4
  KO
K15715  E3 ubiquitin-protein ligase ZNRF4 [EC:2.3.2.27]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    20834 (Znrf4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     20834 (Znrf4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    20834 (Znrf4)
SSDB
Motif
Pfam: zf-RING_2 zf-RING_11 zf-C3HC4 zf-rbx1 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 zf-RING_5 zf-ANAPC11 Prok-RING_4 DUF3565
Other DBs
NCBI-GeneID: 20834
NCBI-ProteinID: NP_035613
MGI: 1341258
Ensembl: ENSMUSG00000044526
UniProt: Q9DAH2
Position
17:complement(56818248..56819483)
AA seq 327 aa
MARFAWTRVAPVALVTFWLVLSLSPTDAQVNLSSVDFLDLPALLGVPVDPKRARGYLLVA
RPADACHAIEGPWPDNHSLDPLVLVRPLGCSWEQTGRRAQRAGATAASVGPEAPGQLREF
EDLEVTVRCDQPARVLLPHAEPCPDPECHPVVVASWALARALALAASTLFVLRQLWPWVR
GLGSRGTAVKTQTCQKAQVRTFTRLSDLCAICLDDYEEGERLKILPCAHAYHCRCIDPWF
SRAAQRSCPLCKQSVASTHDGSTDGSVGGEEPPLPGHRPPIWAIQARLRSRRLELLARTV
PCRRCSSTTSLGVAENVAQSEATSELS
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcgcggtttgcgtggacccgggtagccccagtggccctggtgactttctggctggtc
ctgtccctgtcgcccacggacgctcaggttaacttgagctctgtggacttcttggacctc
ccggcgctgcttggggttcctgtggaccccaagagggcacgcggatacctgctggtggcc
cggccggccgacgcctgccacgccatcgagggcccctggcccgacaaccactcactggac
ccactagtgctggtccggcccctgggctgctcctgggagcaaacagggcggcgagcacag
agagctggagccacagcagcctcagtgggccctgaggccccagggcagctgcgcgagttt
gaggacttggaggtgaccgtacgctgcgaccagccagcccgcgtgctgctgcctcacgcg
gaaccctgccccgaccccgagtgtcaccctgtagtggttgcatcctgggcgctcgcccga
gccctggccctggccgcatctacgctgttcgtgctgcggcagctgtggccgtgggtccgg
ggcttgggtagccggggcaccgcggtgaagacgcagacatgccagaaggcacaggtgcgc
acgttcacgcgcctcagcgacctgtgcgccatctgcctggacgactacgaggagggggaa
cggctcaagatcctgccttgcgcacatgcgtaccactgtcgctgcatcgacccctggttc
tcgcgcgccgcgcagcgttcatgccccctgtgcaaacagtcagtggccagcactcacgac
ggttccacggacggcagcgtaggcggcgaggaaccacccctccccggacaccgcccgccc
atctgggccatccaggcccggctgcgctcccgcaggctcgagctgctagcccggacagtc
ccctgccgtcgctgcagcagcaccacgtctctgggggtggcggagaacgtggcgcagtca
gaagcgacttccgagctctcctga

DBGET integrated database retrieval system