KEGG   Mus musculus (mouse): 208366
Entry
208366            CDS       T01002                                 

Gene name
Rpp40, D8Bwg1265e, Rnasep1
Definition
(RefSeq) ribonuclease P 40 subunit
  KO
K14530  ribonucleases P/MRP protein subunit RPP40 [EC:3.1.26.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    208366 (Rpp40)
   03008 Ribosome biogenesis in eukaryotes
    208366 (Rpp40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    208366 (Rpp40)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    208366 (Rpp40)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    208366 (Rpp40)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     208366 (Rpp40)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     208366 (Rpp40)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    208366 (Rpp40)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    208366 (Rpp40)
SSDB
Motif
Pfam: Ribonuc_P_40
Other DBs
NCBI-GeneID: 208366
NCBI-ProteinID: NP_666050
MGI: 1346084
Ensembl: ENSMUSG00000021418
Vega: OTTMUSG00000037298
UniProt: Q8R1F9
Position
13; 13 A3.3
AA seq 363 aa
MATLRRLQEAPRHLLVCEKSNFGHDKSRHKHLVETHYHNYRVSFLIPECGLLSKELKSLV
MDIGPYYSVKNLPLHELITHEFINTFVKKGSFSALTYNTSIDEDNTVALLPNGKLILSLD
KDTYEETGLQGRPSRYSGRKSMKFVISIDLMDLSLNLDSKKYRRISWSFKEKKPLKFDFL
LAWHPTGTEESTMMSYFSKYQIQEHQPKVALSTVRELQCPVLRSSGLAGEPEEACSALEF
FDWLGAVFCSADLNNEPYNFISTYCCPQPSAVVAQAFLCTITGFILPEKIHVLLEQLCHY
FDEPKLAPWVTLTVQGFADSPVAWREKEHGFHKGGEHLYNFVVFNNQDYWLQMAVGANDD
CPP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggccacgctgcgcaggctgcaagaggcgcctcggcacttactggtctgtgagaaatcc
aacttcggccacgataagtctcgccataagcatctcgtggagacgcactatcataattac
agggtttcatttcttattcctgaatgtgggcttctatcaaaagagctaaaaagcctggtc
atggacattggaccctattactctgtgaagaacttacctcttcatgaattaattacacac
gagttcatcaacacctttgtaaagaaaggttcattctctgcattaacatacaatacaagt
attgatgaggataatactgttgctctcctaccaaatgggaaattaattttatcactagat
aaagatacttacgaagaaaccggacttcaaggtcgtccatctcggtattctggcagaaaa
agtatgaagtttgtcatttccattgacctaatggatttatcccttaacctggattctaag
aagtacagaagaatatcttggtccttcaaagagaagaagcctttgaagtttgatttcctt
ttggcttggcatcctacaggtacagaagaatcaacaatgatgtcgtacttttccaaatac
caaattcaggagcatcagcccaaagtggcattgagcacagtgagagagctgcagtgccca
gtgctgcggagcagcgggcttgcaggagagccggaggaggcctgcagtgccctggagttc
tttgactggcttggtgctgtcttctgcagtgcggacctaaataacgagccttataacttc
atatcaacctactgctgtccccagccaagcgccgtggtagcccaagcttttctgtgtaca
atcacaggtttcatattgccagagaagatacatgtccttctggaacagctgtgtcactac
ttcgatgaaccaaagttggctccatgggtcaccttgacagttcaaggctttgcagacagc
cccgttgcctggagagagaaggaacatggcttccataaaggaggcgagcacttgtacaat
tttgtggttttcaataatcaggactattggcttcagatggctgttggggcaaatgatgac
tgcccaccataa

DBGET integrated database retrieval system