KEGG   Mus musculus (house mouse): 208439
Entry
208439            CDS       T01002                                 
Symbol
Klhl29, A230106N14Rik, Gm68, Kbtbd9, mKIAA1921
Name
(RefSeq) kelch-like 29
  KO
K10465  kelch-like protein 29
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    208439 (Klhl29)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     208439 (Klhl29)
SSDB
Motif
Pfam: Kelch_1 Kelch_6 BACK Kelch_2 BTB Kelch_4 Kelch_3 Kelch_5 KLHL33-like_BTB_POZ DUF1668 DUF6242
Other DBs
NCBI-GeneID: 208439
NCBI-ProteinID: NP_001157965
MGI: 2683857
Ensembl: ENSMUSG00000020627
UniProt: Q80T74
Position
12:complement(5127465..5425682)
AA seq 875 aa
MSRHHSRFERDYRIGWDRREWSVNGTHGATSVCSVTSGAGGSTASSLSARPGLLPLPVVP
SRLPTPATAPAPCTTGSSEAITSLVVSSASAATTKAPGISKADNQSQGLTTSIRWGQTPV
NQSTPWDTDEPPSKQMRESDNPGTGPWVTTVAAGNQPSLITHSYGVTQPPTFSPAVNVQA
PVIGVTPSLPPHVGPQLPLIPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPG
VGQVSRPGPTPVGNGHMAGPLLPPPPPAQPSAALPSSVPATNGPPTTDSAHGLQMLRTIG
VGKYEFTDPGHPKEMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQR
SVQDSSQSSREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDF
IAYVSNDSLNTKAEELVYETVIKWIKKDPATRAQYAAELLAAVRLPFIHPSYLLNVVDNE
ELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQR
SLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLL
DNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVERYDTITNQWEAVAPLPKAV
HSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKYAPAVTLNGFV
FILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM
EAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgtccaggcaccacagccgcttcgaaagagattaccgcataggctgggaccgccgtgag
tggagcgtcaatgggacccacggggccaccagcgtctgcagcgtcacctccggtgctggt
ggcagcacagccagcagtctcagcgcaagaccgggcctcctaccactgcctgtggtaccc
tcccggctgcccacacccgccacggctcctgctccctgcacgaccggcagcagtgaagct
atcaccagtcttgtggtcagctcggcctccgcagccaccaccaaggctcccggcatctcc
aaagctgacaatcagtctcaaggactcacgaccagcatccgatgggggcagacgcctgtc
aatcagtccacgccctgggacactgatgagccgccctccaaacagatgagggagagcgac
aatccaggcacagggccatgggtgaccacggtggccgctggaaaccagccttccctgatc
acacactcctatggagtgacccagcctcccaccttcagtcctgctgtgaacgtccaggcc
cccgtcatcggggtgactccctcactgcctccccatgtgggaccccagctcccgctgata
ccaggccactactcactcccacagccgccctcccaaccgctgagcagtgtggtggtgaac
atgcctgctcaggccctgtatgccagccctcagcccctggcagtatccactttgcctgga
gtagggcaggtatcccgcccgggacccacccctgtgggcaacggccacatggcagggccc
ctgctgcctccacctccaccagcccagccgtccgcagctctccccagtagtgttcctgcc
accaatgggccgcccacaacagactcggcccatgggctgcaaatgcttcggaccattgga
gtggggaagtatgagttcaccgacccagggcaccctaaagaaatgttgaaggaattgaac
cagcaacgcagagcgaaagcatttacagacctgaaaattgttgttgaaggcagagagttt
gaagtccaccaaaatgttctagcttcctgcagcttgtatttcaaggacctgattcaaagg
tcggtgcaggacagcagccagagcagccgggagaagttggagctggtgctctccaacctg
caggctgatgtcctggagctactgctagagtttgtctacacggggtcgctggtcatcgac
tcagccaatgccaagactctactcgaggcggccagcaagttccagtttcacaccttctgc
aaagtctgtgtgtcctttctagagaagcagctgactgccagcaactgtctgggagtgctg
gccatggctgaggccatgcagtgcagtgagctctaccacatggccaaggccttcgcgctg
cagatcttccccgaggtggccgcccaggaggagatcctcagcatctctaaagatgacttc
attgcctacgtctccaatgacagcctcaataccaaggccgaggagctggtctacgagact
gtcatcaagtggatcaagaaggacccagcaacacgtgcacagtatgcagcagagctcctg
gctgccgtccgcctcccgttcatccatcccagctatctgctcaatgtggtggacaacgaa
gagctgatcaagtcatcagaagcatgtcgggacctggtcaatgaggctaaacgctaccac
atgctaccccacgcccggcaggagatgcagacaccccgaacccggccccgcctctctgca
ggtgtggccgaggtcatcgttttggttgggggccgtcagatggttgggatgacccagcgc
tcactggtggctgtcacctgctggaacccacagaacaacaagtggtaccccttggcctcg
ctgcctttctatgaccgcgagttcttcagtgtagtgagtgctggggacaacatctacctc
tcaggtggtatggaatcaggggtgacgctggctgatgtctggtgctacatgtccctgttg
gataactggaacctggtctccagaatgactgtccctcgttgtcgccacaatagtctcgtc
tatgatgggaagatctacactcttgggggacttggagtggccggcaacgtggaccatgtg
gagaggtacgacactatcactaaccaatgggaggcagtagcccctctgcccaaggcggta
cattcggcagcggccactgtgtgtggtggcaaaatctacgtgtttggtggcgtgaatgag
gcaggccgagcggcaggtgtcctccagtcctatgtgccacagaccaacacgtggagcttc
attgagtccccaatgatagacaacaaatatgcacctgctgtcaccctcaatggctttgtg
ttcatcctgggaggagcttatgccagagccaccaccatctacgacccagaaaaaggcaac
atcaaggcggggccaaacatgaatcactctcggcagttctgcagtgccgtggtgctcgat
ggtaaaatttatgctactggaggcatcgtgagcagtgagggaccagccctgggcaacatg
gaagcctacgagcccacaaccaacacatggaccctcttaccccacatgccctgtcctgtg
ttcagacacggctgtgttgtgataaaaaagtatattcaaagcggctga

DBGET integrated database retrieval system