KEGG   Mus musculus (house mouse): 20844
Entry
20844             CDS       T01002                                 
Symbol
Stam, STAM1
Name
(RefSeq) signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
  KO
K04705  signal transducing adaptor molecule
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    20844 (Stam)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    20844 (Stam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20844 (Stam)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    20844 (Stam)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM SH3_10 GAT HEAT_2 GGA_N-GAT
Other DBs
NCBI-GeneID: 20844
NCBI-ProteinID: NP_035614
MGI: 1329014
Ensembl: ENSMUSG00000026718
UniProt: P70297 Q3TQ49
Position
2:14078910..14153296
AA seq 548 aa
MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAI
ELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSA
QMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIY
SPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQ
AYSQKALL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaaccccttcgaccaggatgttgagaaagcaactagtgagttg
aatactgctgaggactggggcctcatcttggatatttgtgataaggttggccaatctcgc
acaggacctaaagattgtcttcgttccattatgagaagagtgaaccataaagacccccat
gttgctatgcaagccttaactcttctgggagcatgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcaagagactttgctagtgaagtaagcaatgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctgatatcggcaatgatcaagaaccttaaggaacaaggtgta
acattcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctctcgta
gccaaggaccctgggactgtggctaccaaaaaggaagaagaagatttagccaaagctatt
gagttgtccctgaaggagcaaaggcagcagtcagcccccgtgtccacgctgtaccccagc
acatctaacctcctcactaaccaccagcacgaaggcaggaaagtccgcgccgtgtacgat
tttgaagccgctgaggataatgagcttacctttaaagctggagaaatcattacagtcctt
gatgacagtgatcccaactggtggaaaggtgaaacccatcaaggcgtggggctttttcct
tctaattttgtaactgcagatcttactgctgaaccagaaatgattaaaacagagaagaag
acggtacagttcaatgatgatgttcagatagagacaatagaaccagaaccagaaccagcc
tttattgatgaggataaaatggaccagttgttacagatgttgcaaagtacagatcctagt
gataatcagccagacttgccagagctgcttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactgtcagaacta
aacgtgaaggtgatggaagctctctcactgtatacgaagttaatgaatgaagacccaatg
tactctatgtatgcaaaattacagagtcagcagtactatctgcagtcgtcggctgtctct
gcttcccaggtatatccagggcctgcgcagagcggtacctacctggttgcagggagtgca
cagatgacccatctgcagagctacagccttcccccagagcagctgtcttctatcagccaa
ggagcagttccatcctctgcaaatcaagctcttcctagtcagcagacccaggcttcttac
ccgaatgcaatggttagttctgttcaaggaaattcgtatcctagccaggcttcaatatat
agtcctcctgctgctgctgctgctgccgctgctgctgctgtagtacctgttcctgtacct
gctgatgtcaccatataccagaatgcaggacctactatgtcccaggtgccaaactatact
ttaacatcatcaaccctgcctcaaacaggaggcagccaacagccacctcagccacagcaa
gcatattctcagaaggctctgctatag

DBGET integrated database retrieval system