KEGG   Mus musculus (mouse): 20844
Entry
20844             CDS       T01002                                 

Gene name
Stam, STA, STAM1
Definition
(RefSeq) signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
  KO
K04705  signal transducing adaptor molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    20844 (Stam)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    20844 (Stam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20844 (Stam)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    20844 (Stam)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM SH3_10 GAT HEAT_2 GGA_N-GAT
Other DBs
NCBI-GeneID: 20844
NCBI-ProteinID: NP_035614
MGI: 1329014
Ensembl: ENSMUSG00000026718
Vega: OTTMUSG00000011399
UniProt: P70297 Q3TQ49
Position
2; 2 A2
AA seq 548 aa
MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAI
ELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSA
QMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIY
SPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQ
AYSQKALL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaaccccttcgaccaggatgttgagaaagcaactagtgagttg
aatactgctgaggactggggcctcatcttggatatttgtgataaggttggccaatctcgc
acaggacctaaagattgtcttcgttccattatgagaagagtgaaccataaagacccccat
gttgctatgcaagccttaactcttctgggagcatgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcaagagactttgctagtgaagtaagcaatgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctgatatcggcaatgatcaagaaccttaaggaacaaggtgta
acattcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctctcgta
gccaaggaccctgggactgtggctaccaaaaaggaagaagaagatttagccaaagctatt
gagttgtccctgaaggagcaaaggcagcagtcagcccccgtgtccacgctgtaccccagc
acatctaacctcctcactaaccaccagcacgaaggcaggaaagtccgcgccgtgtacgat
tttgaagccgctgaggataatgagcttacctttaaagctggagaaatcattacagtcctt
gatgacagtgatcccaactggtggaaaggtgaaacccatcaaggcgtggggctttttcct
tctaattttgtaactgcagatcttactgctgaaccagaaatgattaaaacagagaagaag
acggtacagttcaatgatgatgttcagatagagacaatagaaccagaaccagaaccagcc
tttattgatgaggataaaatggaccagttgttacagatgttgcaaagtacagatcctagt
gataatcagccagacttgccagagctgcttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactgtcagaacta
aacgtgaaggtgatggaagctctctcactgtatacgaagttaatgaatgaagacccaatg
tactctatgtatgcaaaattacagagtcagcagtactatctgcagtcgtcggctgtctct
gcttcccaggtatatccagggcctgcgcagagcggtacctacctggttgcagggagtgca
cagatgacccatctgcagagctacagccttcccccagagcagctgtcttctatcagccaa
ggagcagttccatcctctgcaaatcaagctcttcctagtcagcagacccaggcttcttac
ccgaatgcaatggttagttctgttcaaggaaattcgtatcctagccaggcttcaatatat
agtcctcctgctgctgctgctgctgccgctgctgctgctgtagtacctgttcctgtacct
gctgatgtcaccatataccagaatgcaggacctactatgtcccaggtgccaaactatact
ttaacatcatcaaccctgcctcaaacaggaggcagccaacagccacctcagccacagcaa
gcatattctcagaaggctctgctatag

KEGG   Mus musculus (mouse): 56324
Entry
56324             CDS       T01002                                 

Gene name
Stam2, 1200004O12Rik, 5730456G07Rik, BB145015, Hb, Hbp
Definition
(RefSeq) signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
  KO
K04705  signal transducing adaptor molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    56324 (Stam2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    56324 (Stam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56324 (Stam2)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    56324 (Stam2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT BORCS6 ENTH SH3_10
Other DBs
NCBI-GeneID: 56324
NCBI-ProteinID: NP_062641
MGI: 1929100
Ensembl: ENSMUSG00000055371
Vega: OTTMUSG00000012637
UniProt: O88811 Q3TGH8
Structure
PDB: 
1UJ0

Position
2; 2 C1.1
AA seq 523 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDRVGSTPSGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRSVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGVTFPSAGSQTVAAAAKNGTSLNKNKEDEDIAKAIELSLQE
QKQQYTETKALYPPAESQLNNKAARRVRALYDFEAVEDNELTFKHGELITVLDDSDANWW
QGENHRGTGLFPSNFVTTDLSTEVETATVDKLNVIDDDVEEIKKSEPEPVYIDEGKMDRA
LQILQSIDPKESKPDSQDLLDLEDVCQQMGPMIDEKLEEIDRKHSELSELNVKVLEALDL
YNKLVNEAPVYSVYSKLHPAHYPPAAAGVPVQTYPVQSHGGNYLGHGIHQVSVAQNYNLG
PDPMGSLRSLPPNMNSVTAHTVQPPYLSTGQDTVSNPSYMNQSSRLQAAAGTAAYTQPVG
MSTDVSSFQNTASGLPQLAGFPVAVPAPVAAQPQASYHQQPLL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgcctctgttcactgccaacccgttcgagcaagatgtggaaaaagccacaaatgagtac
aacaccacagaagactggagtctgatcatggacatctgtgacagggttggaagcactccc
agtggagcaaaagattgcctaaaagccataatgaaaagggtaaaccataaggtccctcac
gttgctctgcaggcattgacccttcttggagcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacggaagtacgttctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactaaaatctctaatggtggaatggtcagaagaattc
cagaaggacccccaatttagtctgatatctgcaactattaagtctatgaaagaagaaggg
gttacttttccttccgcaggctcccagactgtcgcggctgctgccaaaaacgggacatca
ttgaacaaaaacaaagaagatgaggacatagctaaagctattgagttatcgttgcaagag
cagaagcagcagtacacggagacaaaggctttgtacccacccgcagagagtcagctcaat
aacaaggctgcacggagagtcagagctttatacgactttgaagctgttgaggacaacgag
ctcacctttaaacatggtgagctcattactgttttggatgacagtgacgccaactggtgg
caaggagaaaatcacagaggaacaggactcttcccctccaactttgtaacgactgactta
agcacagaggttgagacagcaacggtggacaaattgaatgtaattgatgatgatgtggag
gaaattaagaaatcagaacctgagcctgtttatatagatgagggtaaaatggatagagcc
ctgcagattctccagagcatagatccaaaagagtcaaaacccgactcccaagacctcttg
gacttggaagatgtttgccaacagatgggtccgatgatagatgaaaaacttgaagagatt
gataggaagcattcagaactgtctgagttgaacgtaaaggtgctggaagccctggacctg
tacaataagttggtgaatgaagcgcctgtgtactcggtctattcaaagctgcatcccgca
cattacccacccgcagcagctggggttccagtgcagacatatccagtccagtcgcatggt
ggaaactacctgggccacggcattcaccaagtatctgttgcccagaactataacctagga
cctgatcctatgggctcgctgagatctctgcctccaaatatgaactcggtaacagcacac
accgtccaacctccatacttaagcactggacaggacactgtctccaacccttcttacatg
aaccagagctctcgtcttcaggcagctgctggtacagctgcttacacacagcctgtgggg
atgtctacagatgtgtcttctttccagaacacagcatccggtttgcctcagctggctggc
tttccagtggcagttcctgcacctgtcgctgcacagccacaagcaagctaccaccagcag
cctctcctgtag

DBGET integrated database retrieval system